MSCF \:IytK =  +V PKPC30~2.000rY) PCSHEL~1.016+ 0pcshell.015Xc*eP PCFILE~1.014> Xc*\P 00pcirda.013ή(w*ѽ pcheader.012)V? 00random.011I* 0000bit1.010LI*gN BASICM~1.009jI*vL 008queen.008z  )l 0000coin.007) (n FIBONA~1.006r *{ DEVICE~1.005r+ 00pchelp.004.d*m 00cerror.003T.* 0default.002* pceditor.001zMSCE' uZdl uPocketCOrbworks%CE1%\PocketC%CE2%PocketC%CE5% PkCExample%CE11%.pc pktc_srcfile DefaultIcon Shell Open Command .hpktc_headerfile.app pktc_appfilePocketC Development.lnk@ pceditor.exe@ default.dat@ cerror.dat@ pchelp.htp @devicecompiler.dll@ fibonacci.pc@coin.pc @ 8queen.pc  @ basicmath.pc  @bit1.pc  @ random.pc @ pcheader.h @ pcirda.h@ pcfilesys.h@ pcshell.exe@pcshellv2.exe            Defaultpktc_srcfileDefaultpcsrc&Default%InstallDir%\pcshell.exe,-129'Default"%InstallDir%\pceditor.exe" %1Defaultpktc_headerfileDefaultpcheader&Default%InstallDir%\pcshell.exe,-130'Default"%InstallDir%\pceditor.exe" %1 Defaultpktc_appfile Defaultpcapp &Default%InstallDir%\pcshell.exe,-112 &Default"%InstallDir%\pcshell.exe" %1MZ@ !L!This program cannot be run in DOS mode. $#gkgkgkK`kgjkgkkmfkRichgkPE9  |P  Pl%X.textT   `.rdata`@@.data-<&@.pdataX:@@.rsrc%l&L@@"Oe @&O "O_ @&O "OY @&O "OS @&O /"OChO @ 0K @d&O h //"OChSiu?L51.AHC 173B+!N3%2,` @4i @4iЃd @5):` 2&B&m&l&k&j&i&h#o n8 L40< p/"OChnSd @. e!(l @d&O h //"OChSi?\г @4`Гe @4[\ @4 d1(X!$5 @d,?&Oi h/"OChMSd @\ 5M @dI. @d &O h //"OChSd@ @\ 9AЃd @e)&Oi h//"OCh; @dDeUb-bvg4,9`&Oi h "O&<%&$H)4*+ @,L&O /"OCh1?81DeP!@`:$4 @(8 @48Ѓe @4t(u3v8w5x @9,?&O hHLD$P0T`p<"OH$?Cfcgqc=c8# vab-`.ucgqb-b("v5'A =2$16$7 @ Q,b2Q,b2 Q,b2Q,b2(&O ///"OCf)"c @d( @5a! @@idVa:$vg2tg @d @d &Oji h"OCfSg @d&O  PHT\=`xl@x/"OChdH$Be @R(dH$&O h4"OCeX%  @4| @4&O //"OTCchsiPTu @7I 5f2#4Tbt!&G9vD&Oi h /"OChd @ x`A8F3 xha#8f1x`&O hRa&1 AafO 6M6 1$Raq%t C`Ra&1F$Rbr"%t C`//////"OSjckCet?nq 95yTgef @H9Ѓefg @tR|2L}ɍ8 Hlp 2 r%.X12= @e(bWL2V@r"5ayWV3rLtcWVteWVvgWVhyVWj{VfW|mVgVf~o@rVgVfr"aReЍR,&Omlkji h`T<hE,* T T$//"OChQV1 YI5uSidb"e @ dH$B( &Oi h c4 F///L=Slml ,*8//"OChQV1 YI5uSidDb"e @ dH$B( &Oi h c4 F///L=Slml ,*L//"OChQV1 YI5uSiLc2e @ dH$B( &Oi h a F///L=Slml ,*//////"OChSijl;d547 @\ed @( e7df @k{%x+:$d5,7 @=\wed @9Lofe$7d @$mВe @4kgгd6:5(7Hz @4\ged @L]Lef07d @4bГeVԞX @4 d8&Omlkji h//////"OGHUD"!`T(A#S?2"FWQ A A@t @YUR("DHlp7 17 q*94e @TQQ=9 @ S2c32[+R!R"=2 @ i'9Qya1ZgTef @H,efg @t}S3xˍ< Hlp 3 s5 @YD @e)cX\3Wt#qG1WuVrc,&Omlkji h<NhEh=,* T TT`//"OChQV1 YI5uSidDDb"e @ dH$B( &Oi h c4 F///L=Slml ,* //////"OZ]\[@D `$ @if @d`4&Omlkji h /"OCh?( @d  @Fd @5 @d,?&O h /"OChl b@,0&O h //"OCich\ i@ 9< @ deR$B)&Oi h/////"OChdH$4H$Ce0Si 7 {lK<| Jd{K$y @d[d D @t dl$|L9Lj Kd|LzdB(&Olkji h"OC`SdeAAa b(" ftCgqadFFL6wqb-dH$QU @cd&O 4,lX $ C`"Osk @ &O "Oof @ &O "Odk @ &O "O޿ &O "ObY @ &O "O^T @ &O "OP^ @ &O "O޿ &O ///"OG|Ch 8 8 8 8 8 8 8 8 8J @ $:騁FЬ9 @a\1tG3u!>%T&4 @ *7dx @d&Oji h"O") @ &O "O" @ &O "O &O "O @ &O "O @ &O "O @ &O "O޿ &O <ST$N4 4%FNl:);///"Oة @d`AԃjFe:FfUfFeBdWH1UTSDUTUF@D @2*b\2YtW"G3quWVrc (B#`B#`B#`$&Oji h/"O؈(A`A`A``@ @  @d&O h"O| @ &O "O &O ///"Oڑ?wm @dsPv2Fe`FfAR"ja:FfFe b1SFeFfTeFeFfVgFfFehYFfFej[FfFel]FfFen_@rFfFeb"QBdB1P4FeFfSdFfFeeVFfFegXFfFeiZFfFek\FeFf]nFfFeo]FfFen_@qFfFeb!QBdBy @2*cL3W@V5r#yaW1VLtrcWVteWVvgWVhyVWzkWVf|mVfVgnVg@sVfr#aReЍR&0(C3`C3`C3`7,?&Oji h/"O"(A`A`A``@ @  @d&O h"O  @ &O "O( &O `CD4 M*)tE( "O+* @ &O "Oҿ &O ////"O ؃k"гi: @)dB)!` $d!dc2da&Okji h"O @ &O "O @ &O "O¿ &O X4 N4&&g"!!! "! "Okb @ &O "OXk @ &O "O &O //////"OChSicmslHVIY @!Z @ H$v4 @5HC @ q OC @e8Гefg @d 8-0 @d VV: @ 0  J6ծ72 @7 @48 @d @d/ @4P4&Omlkji h //"O?n! @ !8 @44 @( :?pth.t4 FNEh= x+X=Ep4QSe( @4 CL$tBc8#"$Bӂa#A|"d\4H$ CeP1@3@2$ ;B @5? @4<5 @ 5]4.5 @56 @43, @ ,K4C2&B&h#o n /"OshcgSfCe" @&O h ////"OChSkcjsiEd\44E\464Գfg @eЃe ҳf"dg @&Okji hHtNd=SF0hEM<+,E////"OChSkcjsiEd\44E\464{xԳfg @ezЃepҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464daԳfg @ecЃeZҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464MJԳfg @eLЃeDҳf"dg @&Okji h ////"OChSkcjsiEd\44E\46463Գfg @e5Ѓe0ҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464Գfg @eЃeҳf"dg @&Okji h d\4H$ CeP3@2@1 HNENEEFE0ME///"OChSj(A`A`A``@ @  @d* @d`&Oji hD4*///"OChSj(A`A`A``@ @  @d* @d`&Oji hD4*////"OCh2 @d(5H9  %%) @d& @4jD :$(z @d4G$zFE @dx0Bd,4 4 @htЃj%<: @4(Ь; @d,4dz iB   @d @4`&Okji h84//////"OChie 9j :xz<;Hd<= / @T- @d, @T) @d&(T @<,=`ҁTH$" @  @d{ @d,z @d(y @dHЌ9: @dTH$ @ TH$ @ @d( @4 @4 @d&Omlkji hDP$*\T"O @ &O L&//////"OChmQ! dA[+l9гU @dTaH$+)Ck dad!dc3!zac#2*&Omlkji ht'///"OCh@A8 @d dڢi) @ @ I  @d dC`xԃeScC CsC<4Bfh& )% @Sd bac`$&Oji h '///"OChSj* y УU @dTbH$"*)Cj&Oji ht'//"OCh5 @S02fc`3C CsCci6cdfgQq`1Ce|42%vB%`&Oi h (//////"OXChQPaMdfH6R6c\3C`y2,6 DЃe @cdS#`a\1j,BE2g G Gw'|5h& Skv5F FvFl5Rc2$a%. @d,2"dH$@@A1d*L3C CsCce<5Rgx' rb&"%r,L7r-d @U/ @BtB2гd @- dڢi) @ @ I  @d dB,d4"c32"B-U @d&Omlkji h  (TU"b "! "O?GORBgr!4MB @"fB @4{,?&O //"OCh( E @ddD ti?Ѓe @d`&Oi h /"OCeX%- @@ h(+ @ + @ `&O h////"OChSk+ڿd, ! @djЃeB @d iʿd i @  @ гef @d1d ` @dԨ0Bb 2"$`&Okji h !@`P!!TTpT"OH$ @ &O l/"OCha 1 槰d @d x @e&O h "OBd7 @$P&O /"OchBd7 @$`&O h//"OChSiV  @dd9$H$"(@2@1  } ~ B() B() @xB%4 @vd 4B(&Oi h /"OChd4j @ (&O h Ba 1  "OBd4[ @&O "OcgBd4R @&O "OBd4N @5&O "OBd4F @ &O "ORActT=5&O "OT05&O /////"OChSl,1d @ kadۿez; 9`&Olkji h"O]`5&O //"OChSi @dfdeF&Oi h "OO5ϾO `&O @!D(4@"O5椾 `&O "O5斾P&O @aaA,b 1 a)B 1)# :`@aaAB 1 a),b 1)# :`/"OChڿ  濃d &O h //"OCh dؾi9`&Oi h "O @t&O p///////"OChSlcin~k ; ; ;j : : :?>zf@Gd @Z{:@df @G,9L22.AB @D704 @ d@C`bJ 2G 2$ 2 2 2 2 2 2 2)CeP3:P2ߠ P1 P3-E\4&4 @1$H$"@1 @5}\4 &4 DM# "$^n~>@>A415 @44 @d ˢ 5 @dƢ (, @   Dd\f'Ѓe @d " @   #ef @d \ &5 @8TH$e @d  @5@C<;5 @d @d }  @dx SFNh=xЅ @  efg]d @Bzv5 @,4 @d @d sefg @d2 s @ df @njCf<;< en @dr @d `ǁs @d v${5 @df @d  k @d Sb @d ^пeG)KQ)+xCf @<4\ @d b@JB5 @,4Q @d ݡ V @dء @ڳiiff,6 p FЕTWaS5R&Q; @5jF @d* @45dB @  ./ @d!Ҧ" @4d95 @  $) @dғ" @42d/ @  ' @dҀ" @4d& @  O# @d m""d=ENSEFNh= "h!!"  ""] @4df\ @  ae @d\"Ty @dZd\ @  WL @dQ"iNڇE @e d~Q @ j@ @d0iJ @d jd< @ נii9)k9ڣl\<0гe @d dR; @ h* @d0m4 @d hd& @ {9ډn%B",;.{eT^OeT\M>VW @eiҽf)K9+.Ѓe @gi(  @d @   @s " "FENE"|"XLԉ @ IF @ dP @: F~>H @2iBv.D @*i>n< @dCгf @ei9 @di9 @ i3ڣdUf2Ѓe @d 6cedg @fi``2&B&m&l&k&j&i&h#o n //"OCh1?meL5X%P2P1Jk  @ #d @aodf  @4 d>%e @6Jc#@SF 8#$0`i 9 9 9 9 9 9 9 9 9EHy @d dC @dd 弰db,?&Oi h ///"OW 4 4 4 4 4 4 4 4 4+ @Tj5!:`0&Okji h//"OChY 4 4 4 4 4 4 4 4 4PtBaP1X% R$,ЃiD<9 @d"'d i8,9$ @d%d" @d&Oi h//"OShci!N @udfe @7<&Oi h V  V  VC @PTL#X"ph#///"OChn @e$ @4~TUC @Tiz @e|4 @5Uf}TU F4 @5{ @4fu4 @5u @4k4 @Ur 64 @5qfo4 @5h @4(^4 @Ue64 @5dfb4 @5[ @4`,2&B&i&h#o nG$ C` //"OCh 8 8 8 8 8 8 4 8 4 8 4 8JZtCiDx @d=Гe @d8da 19@ @d&Oi h"OV/ @4&O //"O*Ha 13 D 4 4 4 4 4 4 4 4 4%$tCh @di# @d`&Oi h &4 C`"O#N @ &O //"OCh i9 @d @T @d&Oi hvx`hElxd$p*#p@??/////"OlL:dtChk1(lR"; @ `k2"(aS2;)I @ `,b+)`&Olkji h ////"OdL8iltCjQ9o @ d4Dc6RB0  B > Jd4QAd5 QAd5S|3bd+B.d| @df86B @d cs 2+b-br!+:- @d+'<`emd1d+Bd5' @4e, @4m'`eSdT64#@2H$@2  @df @d aq -c=cs1-  @d-'`e#d d+C?&([@&&L&Zx&d$5@k$ )p0'TH$Ce @d=,]D4 @eeD @4 De @4D1dUBSOxDe @4DL6d @5 @d ,x @4r @ddfly׵dd5d|5j6d @5T47L@3$H$@3 dH$Ce dW @ b( %TH$CeQ @T Sբf^ךd RQ4 @*K @ddfEC׉(d 5d2k@<{S2;G @ lKK((8B 'D((Ѓd @5d @56d @5T&4+L@1H$ @1 a b+!(QR+!բfרd R4 @* @dfdyՅח(d @5d?~d @5{Ѓd @5u6d @5T&4+L@1H$ @1 a b*!(QR*!cբf]_d Ra4 @*[ @ddfTVN(\Ѓd @5dYЃd @5Wd @5RЃd @5T&4%L@1H$ @1 aR+b,A(R+bQ,A?բf;d \df38 (;Ѓd @5dണ8Ѓd @56d @51Ѓd @5T4#L@3H$ @3 cQC(5SQC:բfֳd \df̳(Ѓd @5dtЃd @5T&4<@12H$ @1& aaa`.S7c*2&T)|)))&4>>8BB),)բfׇd dfQա~d @5d&@=lQ|< @ LLS2d @4`tQCl< @ `tSL2cL3l:CmQ= @ QMa!`M)& dЃd @5d @5 @4 @4w @4 JdH$s @4 JdtBd5 @$dqd @5nЃd @5n @4l @4a @4 JdH$\ @4 Jd^Bd5 @$dZЃd @5Xd @5P6d @5S5 @4lL @4I @4,'<` '<`'<` 22 L'<` '<` '<`2 ',` ',`',`"424"d @5d d @5 @44la5d @d* @dl4a5d @*d @d*d,*&@p=4>&8BB*@d @=br/")Q2l @ RBQBd @,4c:m1S2= @ RM"`M("*dৡ@Ѓd @=cs?2)R"3l @ SCCR"d @<4amQ= @ MSM2`8#*dzml32*Q<~ @ `5|Ѓd @+B <+A58H @ 6G @eB @T>@BxH8:,:z IdxH OP5BzJ8,8x IdzJ(. @4, @4* @412&B&m&l&k&j&i&h#o n "OARct?4 @6 @ f @5 @,?&O X T*<PEFX@p=&*8BB0+T++$$ C` //"OChSi @ ) @d`&Oi hD4/"OudSBQ!SUsVR#aUTRC@QD @"S#VvQta\1fhfgG2!uqfgbfrc @4P&O h)t//"OChQV1 YI5uSidDDb"e @ dH$B( &Oi h c4 F///L=Slml ,*/"OCh @cde @4QAAR4 @&(2 &O h /"OCh @cde @4UV @4 @4( &O h /"OCh @cde @4UV @4 @4( &O h /"OCh @cde @4UV @4 @4( &O h /"OCh @cde @4UV @4 @4( &O h /"OCh @cde @4UV @4 @4( &O h /"OCh} @cdet @4vUV @4q @4( &O h /"OChn @cdee @4hUV @4b @4( &O h /"OCh_ @cdeV @4bUV @4S @4( &O h /"OChP @cdeG @4DUV @4D @4( &O h /"OChA @cde8 @4@UV @45 @4( &O h /"OCh2 @cde) @43UV @4& @4( &O h /"OCh# @cde @4%UV @4 @4( &O h /"OCh @cde  @4UV @4 @4( &O h\hth//"OciCh @de @4y @de @4$UVQW @4$ @4(",&Oi h/"OCh @cde @4UV @4 @4( &O h /"OCh @cde @4UV @4 @4( &O h "O @cdd@1@3 @2  @@ @0 @ @&O ///"Och}Cj @dixx @der @d*&Oji h/"OChl @ eq @4rfo 4 @5UETE\D4 @U("(&O h ///"OchX @CjiW @deS @deY @4LUV @4P @4* &Oji h //"OchH @d >n2u> 8 @d@ @dg3ad @E&Oi h //"Och6 @d !,J2u> & @d. @dg!ad @Ed @2uaГd) @E&Oi h "O  @ &O /////"OChSd@1oE\4H$0@1 HF,@h(4@,Ap @4;l--dB(2&O h/"OCh34\ @41[--dB(2&O h/"OCh)*H @4'H--dB(2&O h/"OCh 4 @45--dB(2&O h/"OCh @4--dB(2&O h/"OCh @4 --dB(2&O h468:<>@N@/////"OCichCA @dju< @e lm= @ k6 @d0l6 @d kx1 @dg*P @d)"&Olkji h/////"OCich" @dj3 @e l+ @ k @d0l @d kx @df Qd @E)"&Olkji hCHF@/////"OCkchCA @dju< @e im= @ l6 @d0i6 @d l0гj @4k/ x @dg'Sdf @E*"&Olkji h ////"OCh @cdi- @e d% @ k @d0j @d kd @("&Okji hFHF@////"OChSP @cdiI @e dN @ kD @d0jG @d kd9n @("&Okji h /////"OChci41 @djQ* @e lI/ @ k% @d0l( @d k! @4f- @ddD @" j ( @ d @  @d y @dfRdg @E&Olkji hGIH4#DF@P)/////"OCkchB@ @djs; @e ik< @ l5 @d0i5 @d l/гj @4k. x @dg&гfH @d*"&Olkji h////"OCh @cdi- @e d% @ k @d0j @d kd @("&Okji hJKHF@/////"OCkchFD @dj|? @e it@ @ l9 @d0i9 @d l3гj @4k2 x @dg*гfN @d*"&Olkji h/////"OCich" @dj4 @e l, @ k @d0l @d kx @df @d)"&Olkji hMNHF@/////"OCichCA @djw< @e lo= @ k6 @d0l6 @d kx1 @dg*`d @E)"&Olkji h /////"OCich! @dj3 @e l+ @ k @d0l @d kx @df @d)"&Olkji hHF@////"OChCA @cdiv< @e dn= @ k6 @d0j6 @d kd,a @E("&Okji h/////"OCkch$" @dj8 @e i0 @ l @d0i @d lгj @4k x @dgгf @d*"&Olkji hHF@////"OChZW @cdiR @e dU @ kL @d0jN @d kdB灕 @("&Okji h ////"OCh<9 @cdif4 @e d^7 @ k. @d0j0 @d kd$b @E("&Okji h/////"OChci @dj( @e l  @ k @d0l @d k @d, @dI HF@PK @4fB瀕 @dd4CF @d! DtD @ j (7 @ d7 @ 8: @d 6y @dWf,Уg @d&Olkji h /////"OCkch(% @dj9 @e i1$ @ l @d0i @d lгj @4k x @dg гf @d*"&Olkji hH4#DF@P)/////"OCich?= @djo8 @e lg8 @ k2 @d0l1 @d kx, @df&H @d)"&Olkji h////"OCh @cdi/ @e d' @ k @d0j @d kdx @E("&Okji hHF@/////"OCichFD @dj|? @e ltB @ k9{: @d0l; @d kx3 @df-d @ru)"&Olkji h ////"OCh%# @cdi: @e k2! @ j @d0k @d j @didDt @"(ed @6I` &Okji hHF@)/////"OCich! @dj2 @e l* @ k @d0l @d kx @dg @d)"&Olkji hHF@//////"OChciWV @dkQ @e j喐R @ mJ @d0jL @d mTH$TH$B @4l@ @4k=0 @4g7ef @dlTH$P4 @4k2 @4l10 @4g)гef @dlTH$P' @4k% @4l$0 @4gгef @dlPTH$ @4l @4k0 @4gef @dlP*P'  @4l @4k0 @4gHF@ef @dlPP @4l @4k0 @4gef @dlPTH$ @4k @4l0 @4g|гef @dlPPz @4kz @4lv0 @4goгef @dlPPl @4kl @4lj0y @dgaгef @dl("&Omlkji h//////"OGci?h 8UT @dkO @e d哐Q @ mH @d0jK @d mdH$t2!A"@ @de?, @4< @4ae: @4 5 @40 3 @4 1@ @4P. @4,` @4py) @dD & @d;fd @7d2B!"/,?&Omlkji h ////"OChck  @di{ @dg Гf @d("&Okji h,H d, gHF@p//"OChZѫ Y @cdfS碕 @d("&Oi h //////"OCjchKJ @dkE @e iF @ l> @d0i@ @d l9m @4l6 @4k40 @4j1@x @d1defg @-"&Omlkji h /////"OCich  @dj1 @e l) @ k @d0l @d kx @de @d)"&Olkji hfHF@X</"OChY稐T @dT @("&O h /////"OChLK @cdkF @e f倐E @ i? @d0j? @d if"(h& 2ca1 @d1 @(2&Olkji h/"OCe)ShH$A @("&O h/"OCeSh4, @("&O h////"OchCj   @4ix @dg Гf @d*"&Okji hhilmoHF@//////"OCjci`ѷ^ @h`m @4l] @4kZ0 @4jY@y @deTгfg @d-2&Omlkji h///"OChFbi. @ @dg?Гfu @d(&Oji h///"OChcj : @4i8 @43 g["a>.Тf(AR @'(&Oji h////"OChck( @4j& @4 i!Эa$(Ad @)"g,*> @f(&Okji h /////"OChci  @4d@1@3@2 @@jkHF@(,0f @4d@2@1@3 ;*+**;*Xۤ\ @埐 V @dkTy @dfTгeg @dd 4("404"(2"("&Olkji h "O> @cde9: @ &O "O5^\1/ @&O /"O.P2 @  HF&% @&O h/"O#:' @  20 @&O h//"OChci<d @% @4 y @d  >F @4(L&Oi hBCHT<F@XH//"OCich @4 @4} @40z @4x@ @4w @ddy @5)" &Oi h"On @cder @&O ///"OcheCj @dicx @deg @d*&Oji h"OY @cddO @ &O "OOQ @ &O /////"OChSlckBڣiHгd @9eN @ddsP4A @de: @d H$< @de5 @d 1 @ ef d&Olkji h "O'GG- @&O //"Och7' @2 " @d%e!0 @d&Oi h ///"OChci @  @de @d)B("&Oji hnvF<@h=X\, h,$/////"OChck?](d @"iV @4jT { @dlX(;e @4R(4e @2+ U IX9G5 @6c6 a`㔀TB(2t,?&Olkji h ///"OChf?5cd @i8: @d.* @4("Q,?&Oji h //////"OChcj>?n!Уd @k$9 @d Ѓd @)zd @"i @4 x )t  56 @daa.S3*b,dH$QqT,H,4,@Nx+,p04 @4 k5(wгef @4@b@'5u @4 "jnef @4ilnL @4 k(hдf @I`5 ` @d \ @dWY @d2&B&l&k&j&i&h#o n ////"OCich?KЃd @jM; @dF+ @4jC x @df?e @4)"q,?&Okji h ///"OChc?4cd @i6: @d-* @4("L,?&Oji h ///"OCh??"cd @i$: @d* @4("(,?&Oji h ///"OCh?cd @i: @d* @4(",?&Oji h ,l,@x,<+*,)////"OChciÑ?cГd @ke: @d^y* @de\ @4X @4(",?&Okji h ///"OciN @djLyN @d  J95d @6a b#`(&Oji h////"OCh; @cd<$656 @db&$c8027:cy @df9гe @d aa,AdB(24 @U&Olkji h/////"OChci'E# @ l' @dk%y @df гe @d)@ dB(", @U&Olkji h"O @cddF&O /"O@A @8d Ѓf @\&O h`FN@dT//"Ochn^ @de^ @4X @4O$V @4O%S0 @4O&P@ @4PM @4K`x @dGxtDQER'O.@C@<2@4'UVR"aUVbSVUdUVUfWVUhYVUj[FfFel]FfFen_@rFfFeb"QFfFebSFfFedUBdFD2&B&h#o n ///"O0 @ j @ iE @F @Уdf @5\s 5f @2d @d  @U$&Oji h`FN@p\//////"OcjJG @ GiIУd @\x F @4 E z @dmGГd @UEЂd @Ul?Гd @U=Ђd @Uk;Гd @U9Ђd @U1j2@B @,4f5Гe @d ' @dUdVt, @wTH$bd @-TUVt# @w!Уe @dУe @dгe @dгe @de @de @dVe @d @TS > @U<&Omlkji hFN@\//////"OchHًE @ F\|kJde @VmGde @Vj@ @d> @4 ; @490x @d7гd @5TH$2d @53гef @d0гef @dJ( @U$&Omlkji h //////"OCicj Z[0=8_@T @2(bl2TuWB"W3vq @dhz @dj`2 )" @T FN@*)E%.A @ C\ye HГd @VJEUd @V*00;5 @  4; @ed4 @ . @x 45 @ed. @ m Q=x+e @dMcMT3U|B#:ҍQR("08# @ УfT @eTH$ R("08 @ Уfd @eUV @dUV @dR. @U @TD&Omlkji h4#FN@ @*//////"OCicjgZ[0=8_@T @2(bl2TuWB"W3vqT @dhRz @dj`2P)" @T} E%.A @ B\ye IГd @VJFUd @V*00;4 @  4; @ed4 @ . @x 44 @ed- @ m Q=x*e @dMcMT3U|B#:ҍQR("08" @ УfT @eTH$ R("08 @ Уfd @eUV @dUV @dR. @U @TD&Omlkji h4#FN@@*)//////"Oci5c2 @ 2\xj4Ѓde @Vd 1Уe @V, @d* @4m( @4l%0 @4Uf#g @dTH$aГd @k @4l @4m0y @dTfg @eVe @dУeV @dQ  @U(&Omlkji hFN@,//////"OckB}? @ ?\x i@Ѓde @VP2<@V:de @)7 @d5 @4 2 @4 00 @4 - @dm+ @TUVWQ( @dTH$$b#гd @- @4 @4l0{ @dk @dj @TUTV @gVe @dГeV @dQ  @U@&Omlkji hFN@8//////"Ochg @die @4jb x @d]ۓa1h8 9 :V @ X\|mYde @VVde @VNUdfg @TH$IdfUg @JeV @dHVe @d|B @U$&Omlkji h//////"Oci6c2 @ 3\xj4Ѓde @Vd 1Уe @V- @d+ @4m) @4l&0 @4Ufg @dTH$aГd @k @4l @4m0y @dTfg @eVe @dУeV @dQ  @U(&Omlkji hDFN@//////"OzChSicm\[ @ jГe @d-y& @dy(|6d @\}WhSpЃd4f67 @TH$ hidfWS467 @p @dm @d@&Omlkji h/////"OciYꤐT @:l[ @ddO @  kR @4jP y @dFdegR @dG @U&Olkji h//////"OcjA @dl< @4i9 @4h70z @dkV1ڮ- @ m) @d lK-deg>0 @d;% @U&Omlkji h ////"Oci 4 @\xk @4j @daA d$мb(B @+$TH$i @ &Okji h P\hFN@+t\///"Och @d @4@ @4i0 @4j x @dcC b;"Мa(A"\y4 @'TH$h @  &Oji h////"Ochے 4 @\{j @4i @daA d$b(B+$F&Okji h ////"Och~ 4 @\{j| @4iz @daA d$b(B+$E&Okji h ////"Ochkl 4 @\{ji @4ig @daA d$b(B+$G&Okji h //////"OchV٣Q @ T\zlTЃd @]kQ @4fKгeg @dTH$KЧ[d @jlHx @dfAeg @dxA @U&Omlkji h //"OCh78cd @\yUR(&Oi h/\qUR$ " //"Och+ @di. @ 9& @d$ @di$x @de"I @ &Oi h //"Och @di @ 9 @d @dix @deI @ &Oi hFN@6\///"OChcih @djj @ :9c @d4a @dj` @4e_J`X1 @ 2(2U yd @9T2eU$$1 7 @ PTB(2(&Oji h////"OChciy?n> @dj@ @ :c9 @d^7 @dj6 @4e5J6. @ 2(H24C<4V$'V$V$V$V$V$FV$V$V$V$V$V$V$V$V$V$V$V$B yd @&d1e37 @5 PRC&3 SC0C Ѓd @5 @d2&B&j&i&h#o n@6///"OChci @dj @ :9 @d4 @dj @4eJ$t1u,v3 @8 0 @4  y @d(T1e @u @TTB(0&Oji h////"OChci @dj @ :B @d= @dj @4eJ$1t(u3v @8 " @4k0 @4j0y @dd| @ @Tp{ @ei~ @T(2,&Okji h //////"OChclnm(4 @kk @4jg0 @41. 5idd5%5%5%5% @5%ec @dZ @4V 7ef @4^ 6eg @4 dQ @4 NB(4 @2(2&B&l&k&j&i&h#o n/////"OChckn>гd( @i= @4j9 { @dk5 @41efg @47fg @4 d, @4 )B(4 @"2&B&k&j&i&h#o n/////"OChcknгd( @i @4j { @dk @4 efg @4fg @4 %d @4& \@ 6HB(4 @"2&B&k&j&i&h#o n /////"OChcknгd( @i @4j { @dk @4efg @4fg @4 d @4 B(4 @"2&B&k&j&i&h#o n"Oo @ dpom @ &O "Og @ dhgj @ &O "O_ @ d`_h @ &O "OW @ dXWd @ &O ///"OchM @CjiP @deVyi @d*&Oji h//"Och@ @ iC @deKy @d&Oi h/////"Och3 @Clk6 @dj4 @4i5 x @dg3{ef @d,&Olkji h ///"Och @Cji! @de%y @d*&Oji h ////"Och @ k @dj @4i x @dg{ef @d&Okji h\4#|,,([@, ,,///////"OHci?n`bU\ @4Y[FfFedUBdF @4eW` @4`U5 @4lR @5mO @5,9k-6+4:,0-.+,> @d l< @d m: @d8d(M=,*A5 @l9 @5m6 @5,xzk-+̋* @de* @4N/!ДU 7f @4d6B"222&B&m&l&k&j&i&h#o n //"OChci @de @4O' ДU @4 B(2P&Oi h` NL p/////"OChclXdRۜ; @:|M. T @deM @dR02"(a(&Olkji h/"OCh @ ("&O h /"OCh8 @cdd5 @ (&O h///"OChcj. @di,z @df?#ѓe# @7("&Oji h /"OCh' @7("&O h//"OCi @cd h @e  @e)"&Oi hXD,FN ( D4 @@ ////"OChcks @djq @4 io @4 a(Ab"$dCeP13`P3@2@1@3 S?c3`R&Qa`S 6R&S @ WdQ @ Pңe.Q @7 j(( &Okji h ////"OChck@ @dj> @4 i< { @d a8(A)@ae>6 @7 j"("(" &Okji h///"OChcj%d) @' i!z @d j3a(A).1$36 7 @5QdCb)B9"-b2IMdCeP2 P1!@3$@2(@1+4 Q(1"X4#([N@L X 8-QQ("Q a("QQ( "g @dcQd @U 2(2[] @ _ @T(&Oji h //"OChciU @d d@21yP @ddR @ JIBC02(2( H?z<4 @FTd4:o<5%8j<5B% 5e,5uRdB(&Oi h/"OChT?.cd @ d(J>/ @5  `P!d @5 ! @d  @d(,?&O h/"OCh ?cd @ d> @5  ``"((,?&O h0`DNt-@*Pd p | /"OCh?Hcd @ dDӂ>H @5  `\-b"((m,?&O h//"OCh6 @cd3i3 2W046 @%  b"9(PIIdB("! @ ! @T$&Oi h/"OCh3 !246 @% (" dB( @ @T$&O h0X`N@-L *.| //"OChS @cdOi3 2O46 @%  b"9(BTII4BaeSf`2 `1P3P2P1 D("BQ("D a("BQ(". @dQ1'Ѓd @U 2(2 * @ ( @T$&Oi h /"OCh @cdd @ (&O h/"OCh? @cde 6 @4 @d d @5,?&O hXN@h=L p *H.////"OChcj(d @"iz @d 4۳j @d ЕSd @6 @d( Гd @5 S2(&Okji h//"OChci @dd @U(&Oi h /"OCh(cd @"d5 @4 S2(&O h//"OChci @dd{ @U(&Oi h /"OChv @cdd{ @ (&O h/"OChm @cddn @ (&O h/"OChd(cd @"di56 @4 S2( &O h////"OCich?RЃd @kU: @dMx* @deR @4)",?&Okji h ////"OCicht?=Ѓd @k@: @d:x* @de@ @4)"Z,?&Okji h ////"OCichJ?(Ѓd @k+: @d$x* @de, @4)"0,?&Okji h ////"OCich ?Ѓd @k: @dx* @de @4)",?&Okji h   N@  , , -L-d-////"OCich?aЃd @k`: @d\x* @de\ @4)",?&Okji h ///"OCh?Mcd @iL: @dB* @4("x,?&Oji h ///"OChk?ЃdA @")&Okji h//"OChci6 @ddt|@1~@3r@2!M -Гd @$d& @6 Q( "( @ e' @ (- T4FV$V$V$V$V$V$V$V$ @dd @6 Ѓd @5  @d @ e @ T&Oi h N @ x,P .///"OChci[Гd @dt{@1}@3U @djSy @deJ @dj(&Oji h "OC`cdSfe4A @7 P&O ///////"OjChSlsi[ZV?nU89T2 @4+4@%B%d @vm =. @d<'832.A"l,d3 @$4+< @ @de @d 2&B&m&l&k&j&i&h#o n8` hD@L(//////"Oci0$`, @4d6M, @l(0 @4m%@ @4j#P @4TegM6 '. @:S8#k @4j y @ddURB.Уg @ @T  @U(&Omlkji hF@+\BfcWx' r$rUX%R$RUX% aUSR 6R$SfQUSQ6BgsWP7R$ BePaa!QS1SP3SR"$BfbVh& ceSVh&ceSVh& R$QVbR 5b$aVBabR 1b$ CVbQbWx'AAS1Ra4 b%AWrQ4|5b%cB aBVcQcWx'AAS1Ra4 b%AW sQ4|5b%bC a//"OChSi(f`8_USd@c @dl8 @eTQ4DCeKeS`$&Omlkji h //////"OChSm-,%F# @ l#$74 @8kde#fjC4de @7defm @d! @e`$&Omlkji h //"OShci Гe @BdГe @d&Oi hFt< \///"OChSi` @d(W @jU @eWУf @d eT @dM @jK @dgFfgC @$&Oji h///"OCh@$ @:d<Уf @\5=F(12( @"3`&Oji h ///"OChSiQ!+.% @ j%I @J # @ "$df @5' @d @j @b%gГdfg @(4&Oji h/"OChTH$ @ !dH$ @ (&O h  \`dH t\//"OChi# @)t`R&G3uЌ4sR$reqV @rW`&Oi h //"OChЄT @ 9 @d @d&Oi h //"OCht @\iQ! @ dS2$&Oi h//"OChSiU @ udVl11 e}ГcC<1s6vSd<5F @4Rr-&Oi h //"OChSi Vl11 ekГcCSd<4s6vF @<5Qq&Oi h //////"OCkSht TH$'igғf"le2mbabg!'77ES`.v SlL`7 dsmRdX|a! uV4vލ|:U5N @4 ;dUdmu5dQqAR2,*f6dev6@ԣf @e`&Omlkji h//////"OziGBS65?SQ064#@7([6 T TT5 @ d46 @f 0 @X8b`.2, @ @ 9Q8, @ H`H 0$ @ d#' @f&Oi h//////"OChSmclsk+ed5i @ded5e @dz;&Omlkji h /"OChQ! @ `&O h4#([77A//"OChQV1 YI5uSidDb"e @ dH$B( &Oi h c4 F///L=Slml ,*"O7 @ d4 @ &O b%50 @ 06R>4TO- @ F///L=Slml  /"OCeUT @uh- @A.DԆ45 @7`,&O h/"OChJ(A`A`A`%&`&O hn E4#FN8/"OCh"(A`A`A`56 @T @T;d &O h //"OChSi(A`A`A`惀 @"`&Oi h` D "O @Sd&O "O$A`AA`AB`C @AT&O "OCeRaQ A &O /"OChh  wЀ @  s @TpT t֌3g @5 d 4jt @ &O h//"OCh; $` @T ^Z @ d @Tf @T^ЄU @T00W @T T @T 2TH$P @ 2`&Oi h AP "OBUX%JdH$JSd @5 JdH$CeRl02)S`&O "O: @BT&O "O8 @BT&O /"OChH/ @TH&O h /"OChH& @TH&O h /"OChH @TH&O h /"OChH @TH&O h "O @IT&O 8l x  D   88 p8 "O* @GT&O "O% @FT&O "O  @HT&O /"OCht(A`A`A` @ @  @ @ H`&O h` x  8889/"OCh(A`A`A` @T @T @T @TMd&O h L `L `L `L `"O @BT&O D  //"OChSi @ ) @d`&Oi h4//"OChSi @ ) @d`&Oi h4x//"OChSi @ ) @d`&Oi h4///"OwfCiH @8dhFyjiQ9Гe @d`c4FeFfI3R#aFfFebSFfFedUFeBdVGbr"(H&Oji h///"OChjਁ9 @a\1tG3u!%&@ *$2FeFf:YjFfFek\FfFem^FeBd_G8VUj[VU\mUVn_UYJ@D @2*cWL3Vyr#a1W tVrcWVteVUfWH6`D&Oji h////"OChSkcjqH9e7d @waR,16*eg @4h6cQ3de @2*bS<2"*6de^ aR,1*&Okji h//////"OChSicjHOЌ5d 7 @$H8#*kG56=d57 @4\;ed @<-Lef7d @9Ѓd @eefd$&Omlkji h///////"OjYHH?nC,"Hq @R"bBꫠ 4(2'q839kQQ; @ SK2i9[R!R"; @ KQTe @5(4 @"( % ( @4y  x+,<9)9p(L @4kQ @dmK(ef @40J( @4BG( @4v;7ef @ >d @l,fQ"c32"#Q;U\ {Q</ @ (Lg)ԒeV @7Sz2c3a $ @ 92&B&m&l&k&j&i&h#o n /////"OShHLLC7$T2$D1 7 @ 'T@3@2 $8$?; @d ja4 @d  aaq84zd @y0- @T`@,?&Okji h "O֞ &O "O֔ &O "O֊ &O ////"OChSkcjsi+ @d (Ͽdf @4$ $<;@H;`;l;; ;;гe @4dfgc5$&Okji h////"OChSkcjsi+ @d df @4 гe @4dfg65$&Okji h ////"OChSkcjsi+ @d idf @4 гe @4dfg5$&Okji h ///"OSjchsi*} @d Ƞk4due @vj : m @ fea @ b @d`0d @5 c @ ^eW @ X @dP@Q)@)!-@ !HS=OBPR@9"Ʌ@ "H.0OCHODPR@"@ "5.P@@9"@@ ".S#a`C=`)!@)@ -@ !cP @#@ #2Уd @> 1 @ .e% @ & @d5=/Уd @Sf ' @ 'e @  @d!!04V$V$V$V$V$78d5 @  @ e @ @d`L&Oji h@D ;;< L< , <p<8 //"OShsi4$ce$$$$Z @46 e 5  705$ 854 dN4n04R9"" E04e 4P 4 O 4o4P$ 105$ 254 dX4x04 Q@C;!RB""9"4"C 4c4 PC B9 > $R04r 4 Q1)!C;!."+"9""N 4n4 R")#)##2 dT 4Q@B+!F4S #2&Oi h ///"OChir: @a\1tG3u!h% & )(9: @)`S6uW1td'6`&Oji h/"OCh 4 4 4eI2$<=:T(tGd$d$d$d$d$d$d$d$d$d$"Z2ww @dd' @p "g @dhde @f8{ej ʏe ,?&Omlkji h,M* H<0   D //////"OChSi?L_AF @5Q!5ꟛQгef @d3&V<$L25m(S2= &O Td,PHP =d|<|D////"OChSkcjiR 9 9 9/ @Hydfgpede)' @d& @d&Okji h"OCebT@1Sd+^&O //////"OChmeL5X% P2(P1    @  @ @䵠 dc 0F#Xp|i @ dadF @\ TF @4Q!137A<$;mR!R"=S @ MQR` "=N @ MeHгd @5DЬ7TeV @ zQ1ٍy;`oE >T @e i= @T@ :T @yR"9<4 @ `kQK <=. @ ELe', @5S29:$ @ `R "9: @ Id @4d dl&Omlkji h /"OChd qdՐdd&O hdL=PF` (= 4=//"OChQV1 YI5uSidDb"e @ dH$B( &Oi h c4 F///L=Slml ,*`+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ ,`+@ 0`+@ 4`+@ 8`+@ <`+@ @`+@ D`+@ H`+@ L`+@ P`+@ T`+@ X`+@ \`+@ ``+@ d`+@ h`+@ l`+@ p`+@ t`+@ x`+@ |`+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ $`+@ (`+@ ,`+@ 0`+@ 4`+@ 8`+@ <`+@ @`+@ D`+@ H`+@ L`+@ P`+@ T`+@ X`+@ \`+@ ``+@ d`+@ h`+@ l`+@ p`+@ t`+@ x`+@ |`+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ $`+@ (`+@ ,`+@ 0`+@ 4`+@ 8`+@ <`+@ @`+@ D`+@ H`+@ L`+@ P`+@ T`+@ X`+@ \`+@ ``+@ d`+@ h`+@ l`+@ p`+@ t`+@ x`+@ |`+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ $`+@ (`+@ ,`+@ 0`+@ 4`+@ 8`+@ <`+@ @`+@ `+@ H`+@ L`+@ P`+@ T`+@ X`+@ \`+@ ``+@ d`+@ h`+@ l`+@ p`+@ t`+@ x`+@ D`+@ `+@ `+@ `+@ `+@ `+@ `+@ |`+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ `+@ (`+@ `+@ `+@ $`+@ `+@ `+@ `+@ `+@ ////"OChSkcjsi @ гefg @dd @ &Okji h< pT ////"OCh" @dab(1q1$i) @ d @d 5 @d dCcab(1!A!AA32*B+`a!br"*&Okji h`$T(T"O @  C`&O "O  @  @ &O  ///"OChcjX%!BeX% "iyR9dH$ D "e @  @ *e BB&Oji h $($T(T ,T//"OChSi9dH$ D x &Oi h "O @&O ##[(,\&4`P&8dT&8dT\\\\btjzBTpfv8FPTxvqwFI=GIATM?NM8L:Ed!$J9W )f[aZ]"#j  _<bRvUuK4"3$  #yPYFHklA8B;?=>@AB9:zmntuklY  commctrl.dllIMGDECMP.DLLCOREDLL.dllxvqwFI=GIATM?NM8L:Ed!$J9W )f[aZ]"#j  _<bRvUuK4"3$  #yPYFHklA8B;?=>@AB9:zmntuklY  Lp\P\%s\%s.dll\windows\%s.dll\%s.dllLoad: File %s ^|, ---MenuPopup(%s) [%d,%d]-> %d All Documents (*.*)|*.*||%s|%s%sopenfile:PegHelp.exe%d.%d.%d.%dCustomBoot 1975:I = %d, Begin: %d End: %d Type %d CustomBoot 2000:\Windows iched20Fail to executePocketCv2 runtime cannot recoginize the program Please visit http://www.orbworks.com for the latest runtimeout of memoryMemory Usage: Before %d After %d ***** LocalAlloc: Failed LocalRealloc: Failed ReAllocate Memory PocketFile::SetLen Failed (%s) PocketApp::Shut() PocketApp::Shut() -- Finish Destory Windows EDITBUTTONCOMBOBOXLISTBOXSCROLLBARSTATIC Application Exiting ... About %sShow &ConsoleHide &ConsoleProduced by PocketC Demo. Please Inform Author to Register PocketC %dPocketCPU: Ask to stop PocketCPU::Shut() Invalid handle PocketCPU::Shut() The specified object is a mutex object PocketCPU::Shut() The state of the specified object is signaled PocketCPU::Shut() Timeout PocketCPU: shutdown finished Out of rangeProgram Counter: %d Error: %sNegative array indexAttempt to increment stringProgram Counter: %d Error: %s <%s>Attempt to decrement stringOut of memory while concatenating stringsAttempt to subtract stringAttempt to multiply stringAttempt to divide stringAttempt to mod floatAttempt to mod stringAttempt to negate stringAttempt to & floatsAttempt to & stringAttempt to | floatsAttempt to | stringAttempt to ^ floatsAttempt to ^ stringAttempt to shift floatAttempt to shift stringAttempt to ~ floatAttempt to ~ stringStack corruption detectedAttempt to call non-present builtin function[vmUnLink] Stack corruption detectedopcode undefined PocketCPU: Run Finshed: _WeOuttaHere by Dewey Stack Level %d Ff(D3&! IZ UBb %%.%dfPlease Register PocketC|0ALERTCONFIRMserdataObsolete Function call %ssercloseserrecvsersendpktDBrecdel: Delete Record ID %dUnsupport Database Value TypepktDBrecreadprop: free read memorypktDBrecproptype: free read memorypktDBrecpropcnt: free read memorypkgDBrecpropval: free read memoryLast Error %dbb      4pH8 L `  X\ p &  $4 H \ p sX   Lh! -! - " -|" -" -#0#0T$p4% 4& L&B&Rt' '6 ( ))),*`*+<+X+x+K,H,l,,, ,, - &L- d--,-. .<.\... . 0f0]78t9>:6p::|<*T< h<%< <Np=3=.4>3> @<AFAI8B'B<CD:xD$D$E  ([R[\>\/\]L]]]^<^x^^^,_h___`>`,`,aha'aa%з&<Bo:@<tĻ$ )x )̼ )  P )!X!!l+@D v0p'(v D8  ` z 2@/ .x* 0Hb  _T C" 8%<T)<p'! j z   j\ +H.& , l0 ,d x ,=  <`,   F!(\84r F N@D| E G mt f@6 pB / D$ d"!@ X \@.Z@h[    L - -H \Bp2 '  U 3 X& ( 0D.P  $ N4 T  D <  @P h ( @ X pefgf fp0H`x         0 @ P ` p             0 @Pq8t(u(vy(z}( (T<(bN<~R8܏&`u"y""}"0"d"(( @DDHDDDHLHDHLHDHLHDDLHDHLHȈDHLH HLHHLHHLHHLHHLHHLHHLHHLHHDLHHDDLHHDLDHLHDLDDLHDLDDLD@D@DHD@HD@D@??( DDDDHD@H@@H@@@@@DHH@D@DHDDD ((  x"(""( @ w ww(." @.""@  bB(($"$""$"*"" """""" ( ( x ( @wwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxwxwwwxxx?( ( x ( @wwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxwxwwwxxx?( ( @DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD@DDDDDD@DDDD@DD@HȄDD@ȈȞȈ@DD@Ȅ@HDDȄDL@D@@H@DD@HHHDD@HDDHDDȈ@DDHDLDDDDDȈDD@HȈȌȈDD@̌̈ȈDD@HHDD@@DDDDD@DDHDDDDDD@DDD@DDH@@DDH@DDDDDDDD?( DDDD  ( ( @ĈHHHHHH@D@@@HHDHHHDHH@HHDHH@HHD@DDHHDDDDDDDȈȈȈȈ??????????????( DDDDDDDDDHHHHHDDDDD ̈  ( &FileB&About ...C&Show ConsoleA&ExitShellHRemoveIRefreshA&ExitShellFSend ...GReceiveHRemoveIRefreshA&Exit:MS Sans SerifP,(4VS_VERSION_INFO?StringFileInfod040904b0Comments CompanyNameHFileDescriptionPocketC Runtime6 FileVersion1.0.1.1 0InternalNamepcshellFLegalCopyrightCopyright 1999(LegalTrademarks@ OriginalFilenamepcshell.exe PrivateBuild8 ProductNamePocketShell: ProductVersion3.0.0.0 SpecialBuildDVarFileInfo$Translation PCshellConsole WindowIncompatible Applet. PocketC Virtual Machine Exit ProgramAbout this applettoggle console view Draw Window Hide ConsoleSend ApplicationReceive ApplicationErase ApplicationRefreshMZ@ !L!This program cannot be run in DOS mode. $nnnvNnonnn̈hnRichnPE< ~4~8   pL.text8|~ `.rdata  @@.data-p8@.pdatap@@.rsrc  @@"O^ @&O "OX @&O //"OChSi?NІ @4NAF @5|yUEu @4s5i4n9ГdBՃg @6; @d 44Ճf @d6 @d /1Ճf @d1 @d J,?&Oi h /"OCe' @4( @45( @4 @4X @4`D&O h/"OShCe @4 @4 e` @4  @4 @4&O h (rئ|4`4r@rLr///////"OHSlcmsh[ZY?n婐U]У @4J4cC<4N$U$U$U$U$FU$U$U$U$U$+fRQ44HGD @ G @4fuW6 SdvD7L7qc=`|1')H>Гe @4`5f%Df%f%f%f%f%f%LS2A.&H A2J.C$;"N1,;<` @4i @4i* Ѓd @5)`#2&B&m&l&k&j&i&h#o n /"OChSd @. e!( @d&O h8 (rXrH|drpr4r|rr<//"OChSi?YХ @4[Гe @4W\ @4 d1(S!$5 @d,?&Oi h//"OChSi@ @d F\ @d 5E @dA. @d1 &Oi h //"OCh1 @duW4S`@a9`&Oi h"O(<%&#H)4*+ @,L&O /"OCh1?81DeP!@`:$4 @(8 @48Ѓe @4 t(u3v8w5x @9,?&O hHprrr4rr|rr///"OCf]YcT @d(^ @5a!V @@iuW2SdMDNC`: FЄg @dL @d &Oji h "OCfSg<=o @d&O //////"OZ]\[@D `3$ @i*f @d`4&Omlkji h /"OCh( # @d  @d&O h/"OCeX%  @@ h `&O h ////"OChSk+޿dC  PrrrPrqrrs ssH @djDЃeB @d id i Cгef @dd `9 @d9Ԩ0Bb 2"$`&Okji h"OH$8 @ &O //"OChi.56 @d , @4? %' @4d)%`&Oi h //"OChi'9$H$= 2)  @4 @d @d&Oi h /"OCh @ &O hH$s|0sT@AF @5Ss4QR&1#,NV @d1Фd @e j; @d, 9Гd @z Zd 8 @5d3 @ *e3 @d1d @5d* @ d" @ d dl&Okji h/"OChԼ ӽdd"d低&O h/"OCh t @%0(C3`C3`C3``&O h`H ss$0ssXXsT/"OChu(A`A`A`re x @d&O h//"OChSib )g \ @4g# ` e @4 c\ @4 f \\ @4 Z 5 @4eP @4H @4KЈ @ eG @d00&d&Oi h/"OChQ!Q!9e @ ͱd9ЁUS1R @T&O h/"OChTH$/ @ !TH$+ @ TH$04( @ %&O h //"OChSi TH$Bb"`&Oi h//"OChSi Q! x Гd @e` @d`&Oi h0@|Tsts`stp4//"OChC Q!Cd (TM`. *MeX%.05,M-b("`&Oi h /"OCh TH$B` )&O h/"OCh TH$BaB 1)&O h/"OCh TH$B``&O h /"OCh TH$B``&O h /"OCh̰ TH$@BaB(!`&O h /"OCh TH$B``&O h /"OCh TH$B``&O h /"OCh TH$@BaB(!`&O h ///"OChSins = 5 @4> @4 69 5 @4QdAAR"`-`\.\ @4d5e. @4( @4'd @5# @4`2&B&i&h#o n//"OChSi,  @4UX%(u @4d @5 @4`&Oi h /"OCh TH$HP&O h C` 4|TP/////"O?PF3D @4 ?MEC7$T2$1 7 @ (T@3@2!$8$<z4 @d0d8DiL9b @-d c` ʇ=cs<8+ @T`@,?&Olkji h"O&%֜ &O "O%$֒ &O "Oֈ &O ////"OChSkcjsi+ @d *Ͽdf @4& $(rܨprD  t,t`l8tDtгe @4dfgc5$&Okji h////"OChSkcjsi+ @d df @4 гe @4dfg65$&Okji h ////"OChSkcjsi+r @d gdfll @4 qгe @4dfg5$&Okji h ///"OSjchsi*[ @d X4duQ @vj :S @dV0d @5 M @dP@Q)@)!-@ !HS=OBPR@p9"m@ "H.0OCHODPR@"@ "5.P@@9"@@ ".S#aHC=`)!@)@ -@ !cP @#@ ##Уd @>  @d%-Уd @Sf  @d04V$V$V$V$V$78d5 @  @d`L&Oji h(r,prPtr\thtttrt//"OShsi4$ce$$$$o @46 e 5  705$ 854 dN4n04R9"" E04e 4P 4 O 4o4P$ 105$ 254 dX4x04 Q@C;!yB""""C 4c4 Pkk g9 $cR04r 4QZ)!C;!W"S""9""N 4n4 RD")#B)#2@#2 dT 4@QB+!F4S/#2&Oi h /"Och<7,f'f'f'f'f'f'f'f'f'f'f'%B(( @7P<&O htt/"Och<7f'Cf',f'8(f'f'f'f'f'f'f'f'% @7P<&O h///"OCh<4,$$$$$$$$$$$y@C3 Ѓde @7 z`<&Oji h "O{<7f',f'f'f'f'f'f'f'f'f'f'7% @P<&O //////"OzChSmcl[Ab"C02djeƿd=:yB+,mdef @d @TЃdef @&Omlkji h //"OChRL @ N @d G @dOBdH$N @ IBdH$J @ ip9dH$8 @ 2)ei9dH$B @ 2)Y8dH$= @ 2(&Oi h"OSdcesfW. @ &O ///"OCiShmd\4H$@2@1Z & @Qdd ifГe @dCГh8 @d d @d,,d`dhcrstrXsX(إtܥts td儰 &Oji h //"OCh0X4V$iV$9V$ V$V$V$V$V$$cX @5 Nr'Lq㇐K(49 @: KMK @dRv("&0&Oi h ///"OCh:Ѓjd:6q4փi09aS5R&QO:S8Ia @K)d, @R("a`0&Oji h "O3Cf6bbP2X%R&(N @ !N @&O //"OShci0 duef @7<&Oi h\`dhl @xsprx|}p rts<H"ON`] @&O V V V //"OChnW @eV @4STUH @Y 5O @4OUTSD @4NfA 4 @5F @4B4 @U ;6(4 @5?f8(4 @59 @4(54 @U .6(4 @52f+(4 @5, @4`2&B&h#o n/"OCh!B( @A @`&O h //"OChi9 @d @e&Oi h "O @4&O \R`hTHtrtttuuru@?"OǑk @4&O 4 C`"ONa @ &O /"OChj VЃd @4S @d&O hvaUbfb/EEQdU /"OChHv4be @aVUTTETE &O h /"OCh=v4be @aVUTTETE &O h /"OCh2v4be @aVUTTETE &O h /"OCh(v4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O hRhT4 |(u4u@uqLuXudu/"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h /"OChv4be @aVUTTETE &O h ///"OchtCjUV0xR4$ @gUTUFTE2$&Oji h /"OChnv4be @aVUTTETE &O h /"OChdv4be @aVUTTETE &O h "OdT@1@3 @2  T @@ R @0 O @ M @&O //"OCiClXv @cddB @e"&Oi h/"O, @Che>0 @4=f-0(4 @5Q$AA R4 @(e" @4UTTETE28&O h//"OdUX%$"Ci @dXd @ed @ e @4UV @4 @4" &Oi hpu|uuuuutuuuuuuv vv$v0vutU$U$FU$U$U$U$U$ E@6E&EE&E&E&E& ,МV/ @4+ДUTTE @4e( @4#@V W5 @4'@4 @524,?&Oi h/////"OChn`05GE%E%E%E%E%dVh&/c`0p e975'u]e0CcCt F FU(r|uutso--dD2&O h/"OCh97Z @44X--dD2&O h/"OCh/-F @4*C--dD2&O h///"OCicj" @Uh8z @d/g @d&Oji h //"OChci @Ud yQE @V&Oi hTVXZ\^`CrvLv///"OCicjsx @UhuX @4gm zSEd @V&Oji h /"OChci @dUd`й @&O h /"OChX^ @dUdUФ @&O h ////"OChckKQ @UjGУd燕 @Vi09xEF @d @4 @Dg; {REd @VPIx% 9Ѓd @U6 @T&Okji h ///"OCicj+0 @Uh-X @4Hg$ zd @V&Oji h/"OCh" @dUd/ @&O h ///"OCicj @UhX @4g zd @V&Oji hMFGIJKrtsL//"OChcikn @Udhȕ y @V&Oi h ///"OCicj^` @Uh]8z @dgX`d @E&Oji h//"OChciNQ @UdKЏ y @V&Oi h /"OChBE @dUd?a @E&O h///"OCicj68 @Uh5X @4^g/ zd @V&Oji h/"OCh'* @dUd$C @&O h /"OCh @dUdb @E&O h////"OChck @Uj Уd @Vi09x @d+ NrLq4 @Dgmӕ {d @VIP% lxd @Ug @T&Okji h///"OCicj\b @Uh_X @4gW zd @V&Oji h//"OChciLS @UdKЎ y @V&Oi h /"OCh@G @dUd?x @E&O h//"OChci4; @Ud3 yru @V&Oi h////"OCh'- @dUk# @dj$9d @D"гdf @UPJx Ѓd @U @T&Okji h ///"OCicj @Uh8z @dg @d&Oji hvrtslvL/////"OChci@ДU @:UX% k`5RVh&TWdV @UdUX% `5RPX gгdV @UdUX%`5RP u @SdUgгd @VdP `5RVh&TW fгd @UdP `5RPX g f}гd @UdP`5RP {u @Sdg fsгd @UdP`5RVh& qT\ @4fiгdg @UdP`5RP X lf @4f_гdg @UdP`5RPu\ @SdlZz @dfS ydg @UdD2&Olkji h ////"OCicj@Ck"<;UX% 5 CuFBD @F 9@ @  ?: @47e= @458 @4Ze8Ѓd @,4R@Q34T`D1TcE@B,34TPB(Ab2$T`ACa<1TpBB",:TCg6 @V"&Okji h ////"OCicj@Ck"<;UX% 5%   @f `drhDXsLrnt @  Co @4leo @4j8 @4ejЃd @,4@㶕34T`D1TcE@B,34TPB(Ab2$T`ACa<1TpBBc,34THCAT:TgF.K @V2&Okji h /"OCeHShylW.@x @dV2&O h/"OCe>She6c @dV"&O h/////"O@-AlZcbdU2@`l3l14\Ci[- @$Xd&efg @%2&Olkji h//"OCidU @lXd @e"&Oi h/"OCh @d @"&O h`dfgoxsrqsDXLr//"OChn"pr @dU)n2fh& mĐɕ.e @df @2&Oi h/"OCeaShYЪ @"&O h/"OCeWShOЕ @"&O h/"OCeMShlW.EЅ@v @dV2&O h /////"OCkcl@=Ad4 @t<`2@3 |4Zh;\ @$Yd1Уfg @e"&Olkji h////"OChck):. $ @4i&{ @d3gГf @d&Okji h///"OChlU@l1TMcv. ]j(C;* @cdf Уg @d&Oji h`hijklmrsq@XLP!////"OChckU@Zм1TMc]jX(C4v @;*eO @4K @4{K҈. I @dfCУg @d&Okji h/////"OChcl@1T@2@1@3 @`34T@1@3@2 +;+++(B" @$8 @4i"| @de3g @fd4404 4"&Olkji h "O v @cd e @ &O `kxsr|Xs""OkŐƕec @&O /"Odطg @  ZY @&O h/"OYء\ @  ON @&O h//"OChciJ<4 @%F8 @4XyC @d uB>@F @4L&Oi h //"OChci; @4P@34P`2$Pb@A2$Py+ @dd. @5 &Oi h "O!v @cde @&O ///"OCicj8 @4hz @dd @e&Oji h "O v @cdd @ &O `dBCrvrXvvvvt/"OChNQ @4&O h ////"OChSkcjD @4eCٓd>t @4dnP4 z< @de> @d H$ z6 @de8 @d 0 @ efd&Okji h &D$A $//"Och%7 @x @de-#֞ @0&Oi h ///"OChcj @z @de ֞ @)D"&Oji h` RxsT`vwXs"H///"OChcj4 @"e(Y@z4 @Z(Уe @4 U yX95 @6c6 a`㔀TD2m, @44&Oji h///"OChcjj4 @"ec(Y@z4 @Z(lУe @4 U ZX`95 @6c6 a`㔀TD2Vі\UZ @J, @44&Oji h///"OChciR: @4?*Z9 @dFТ) @484 @"&Oji h /////"OChcin<: @4)*:d @[1 y*"4 @Y  @4{ ) @4s " @UQ @4 jУef @4e 4 @EUV @4 @4@x Уe @d? ` |4vXswlXdp @4 &Oi h "O=> @dU&O ////"OCjck7@14 @Xi38{ @dd3Ѓf @e"&Okji h ////"OCjck%@184 @Xi!{ @dd!Ѓf @e"&Okji h ///"OCicj @4h8z @dd @e&Oji h pr|84 wT,wX8w ///"OCicj8 @4hz @dd @e&Oji h /"OChv @cdd @&O h /"OChv @cdd @ &O h /"OCh}v @cddw @ &O h /"OChsv @cddv @ &O h ///"OChci?j @4cy @dcj]W7"e% @&X4 @5"S0cЃd @U<вd @Uj<Ѓd @U:вd @Ui.$ @4f-Ѓe @d ( @dUVdt( @wTH$bd @-TUVt @w"Гe @d Гe @dУe @dУe @de @de @dЃeV @d @TS > @U<&Omlkji h`rprwwwXxwxx//////"OchLُN @ K||kEde @VmBde @VT@ETF2$T`xGTHj:5 @dTH$5d @52гef @d/гef @dV+ @U$&Omlkji h ///////"OCicjn#0Z4Sf @[X z[`3$2 @T 5> @ |zi Уde @VK УVde @4 @`w(xXXXw {Q1%lq6e @dSxmЃe6d @8QmR"=0xC @UN @T02&B&m&l&k&j&i&h#o n///////"OCicjn<0Z4Sf @[X z[`37$2 @T ,5H>/ @ *|zi$Уde @VK!УVde @ 4 @{Q1B6e @dSxЃe6d @8QmR"=0x< e @daMTMU1B!֯Q``w4xXXXw S8#08M @ EVd @eTH$ S8#08E @ =ТdV @e:ГeV @d7Ve @d9 @4S`>0 @U8 @T02&B&m&l&k&j&i&h#o n//////"Och&B( @ $|{lгde @V`=de @V@Ќ:WdQVU @TH$]WVUd @ eV @d Ve @d  @U &Omlkji h`w(xX@xw //////"Och[[ @ X|yjTГde @VP BPЃcV,3de @8 @OBQmQ,=S`<@R;WdVU$5Q @TH$ CS]4S\WVUd @68УeV @d6Ve @dQ_1 @U4&Omlkji h //////"OdZl['@vdTbBH2%L:iL;H9# @ !||mde @Vde @VUdfg @TH$dfUg @eV @d Ve @d  @U$&Omlkji h`LxwXwXx//////"OchKيM @ I|{lDгde @VA`=de @V@:Ќ:WdQVU @TH$4]WVUd @2eV @d0Ve @dT+ @U &Omlkji h//////"OGSmsl[Z\"% @|yh!e @d(d @6W\Re$f&' @TH$ ВdeWR$f&' @ @d@&Omlkji h`LxwwXdxpxw|xx/////"Oche꺐f @:k_ @4db @  l@2$Z xWdRex%P @dP @U&Olkji h//////"OckF @4@X2`{j\C=vD @$YC @d jTLe6g<52 @d]2 @U&Omlkji h //"OlU@dTl1W\c*|a*LdC;$(A|x @$TH$i @ &Oi h //"OdT@CcaDlR%<1&`Tl2$U@vdV\alcLbA#(B+#|x4 @7TH$i @  &Oi h` rwxXwwx[@lTl1ULadVlfA&\b(B+&|s fS@lTl1ULadVlfA&\b(B+&|s eK@lTl1ULadVlfA&\b(B+&|s g///"Och?n@ @ =|zd4ЌVU @WTH$0ЌVUd @WW0 @U&Oji h .|qUdVhT " )|qUT " //"Och @Y9  8 @4ReB. @ &Oi h //"Och @Y9  8 @4ReB. @ &Oi h`xx@xwXw///"OChcj~ @Y986}$84 @"eQAsx1o @ !rXz)d @T 2eo$$17 @ PTD2b @T(&Oji h ////"OChci?nU @Z:MKS84 @eRBJ.O2 @$ 7JЁ @4EC2.Xyd @T3eB4 @7 PaB2bB0B514 @5. @TM2&B&j&i&h#o n///"OChci# @Z:20"8 @4ReB.!$t2u,v1' @ `1TJXy @dT(3e 4 @uj @T20&Oji hx@ t4r,tDtx////"OChci @Z:><8 @4eRB.$2t(u1v' @ $`М; @4j{ @dkXy @di @d@Tp @ei @T,&Okji h ///////"OChcin @Z:ig`; @4jJ @4 { @dm4$0$x$$3``|: ``n4 @[;+P8$ p @4SegC>ot2uv @( c @T Xyb[ @dde[ @k[ @dX2 @T2&B&m&l&k&j&i&h#o n/H$03`1%QH$CfD)&h&v0vmf9'6vmf`@DxetDLdQ fQaa`Qa% h //////"OChcin1 @Z:  -84 @Re#B.(2 @$  "@;&4 @1Ted17 @ { Z @dl{ @deT17 @ l @T^ prtx@s t,tDtPx @4TDt @D,k).P%Q:"zQ1eP3G9 @ :SG5 @6a.7 @4@2&B&l&k&j&i&h#o n /////"OChckn.84 @Yj$@{4 @[7ef @4)6g @4 e @4 T6"R5 @#c2. @442&B&k&j&i&h#o n``ts tXstX\/////"OChckn84 @Yj@{4 @[7ef @46g @4 e @4 T6"R5 @#c2.䀊 @442&B&k&j&i&h#o n /////"OChckn~84 @Yjw@{4 @[qefg @4tfg @4 dl @4 iD4 @"2&B&k&j&i&h#o n /"OChddUW @6 S442&O h"OWM @dU&O ////"OChck@1 dCecP2fP1iP3p@2 s@1  yQ1U8Уf0 @5dD&Okji h /"OCh&o,dU @6 TH$ @2 @1 @3 ic#`f`s3` dC`"&O h //////"OCh@l1]MB d\ v4 @d[`Xdz=tvгe56 @d eo6d @5 q4 @0&Omlkji h///////"OChci?n`bU_ @4Y^VfVddEVdFX @4eZ` @4`K5 @4lH @5mE @5k,6-4+2,0-.+,> @d l< @d m: @d:de4EE1\1(M,!A5 @l- @5m* @5zǯk* @4e+ @4^ 5 МU7f @422&B&m&l&k&j&i&h#o n //"OChci @4e @4O' МU @4 B2P&Oi h`xx`t4rīr////"OChc۵dT;G:_8v. \ @cdeW @dR02$a&Okji h /"OChMчE @ "&O h /"OCe@Sh @dT&O h /"OChcdLVDU:a.3 @72&O h /"OCh1N) @7"&O h/"OCh';# @dU"&O h //"OChlTdYMe@l2$TMcSd(CSa;!CeP3#`P2(CeP1(P3+@2D@@1)F pna`Hx`dry yy$yXpn06pn-b#`*pn&pvdd3d`@#1d`dd2C`3d`dd4C`5dddeC`6S`7Sxv @cdRӚN>RT @O琐e.O @7 dD &Oi h/"OChlTMbdU@vdTMc(C;"$<@h7.; @ dD &O h//"OCh) 'dTHMa) vdTMib(B+!$>!2$167 @R("mQdCb)B9"-b2aMdCeP2P1CeP3P2@1(@@3.H S4 cS2SS4 cS2S4x`0yXsr<4$( @5  `P"4 @52 @4"  @4&,?&O h /"OCh?dTH$> @5  ``$,?&O h0dHy,0Ty `y/"OCh?dTH$Rӝ>N @5  `\-b$,?&O h //"OChdY3 t2=6;4 @%  b"9PIIdD"0 @T$&Oi h/"OCh)3 B2#46 @% " dD @T$&O h///"OChdY3 2 46 @%  b"9dx0Hy0y TII4BaeSf`2`1Sf`3`2P1+@P3 6 DcBSD cBS4tDf3D``#1D`De2S`3DfDec`4S`5De@dS`6C`7j @4f2Q14 @U$"m @T$&Oji h/"OCh\v @cdda @ &O h //"OChci?UЍ @4GR @YfCEՓg @4D4 @5"v,?&Oi h////"OCh"d[ vdTH$$9:Уi @d 2ГdS @69 @d /d @5 S4&Okji h /"OChlU @dT&O h /"OCh""dT5 @$ S4&O h/"OChlU @dT&O h(r<)ly4$xyXy4r@\y /"OCh @dT&O h/"OCh @dT&O h/"OCh"dT56 @$ S4 &O h////"OChci: @4*:d @[ y*4 @U4 @"&Okji h ////"OChci: @4*:d @[8y* @de @44 @"&Okji h////"OChci: @4r*:d @[* y eq @4i4 @2&Okji h////"OChcil: @4\*:d @[d8y* @de\ @4R4 @"&Okji h////"OChciU: @4E*:d @[B y*4 @U<4 @"&Okji h ///"OChci?: @49*TD @4*24 @4&Oji h ///"OChci-: @4(*TD @4㈁24 @$&Oji h///"OChci: @4*TD @424 @4&Oji h|4yPhy`y ////"OChckPUٗj<:d4O @ N8{ @ddEГe @<59*Fe @4!"E@Гju:q9e @d (y;e @4 8 @d58Ռ4 @2*&Okji h /"OChdTt|@1~@3r@2; "TdT @6 Q") T5F%F%F%F%F%GF%F%F%F%F%dT @6 4 @52  @4"T&O hTsXy`stT/"OChdTt{@1}@3OlUdT @eT"&O h "OC`cdSfe4C @7 P&O ///////"OjChSlsi[ZV?nU89T2 @4(4@%B%d @vm =.( @d<'832.A"l,d3 @$4+< @ @de @d 2&B&m&l&k&j&i&h#o n8`Ptry}wh~yy4rw//////"OchSٙS @ `MCa<1ZPCa<1&@\Bc`,31[4 @4]ezgL6ly < @4d> @ dFR("@T1[ xWJU/Ю1 @+ @TQ+ @U &Omlkji h /////"OChcl `2Y@34Z4 @$[e*.g6 | @dd @ dFTD2&Olkji h"OdTH$ @ &O `rw<_Xwx//////"OG@dYlQl2$R`.l34S@=cbA2$RP,Cca<1Q`Bcc,34Sp:A6)dZ\4O":J\C2R؜T @ mOJK|{ Qd @\:lLГe @dIdUVWS4S6R'a @TH$@вdUVWQQS7b @(= @dO42_1 @U@&Omlkji h ///////"OChndY))$2lR"@l34S4`l1Q@ccB,3P4SA5cb2$R#`Cca<1pQBcc,34S1@cbA2H$RC".<6H$dZ$i2&:J$_2`wXdxpxw|xxc'.d @ m`JV|{ ad @\:l\Гe @dWdUVWQQS7R(ac @:TH$LвdUVWS4S6R'Qc9b @*I @dr42S>8 @U 2&B&m&l&k&j&i&h#o n ///////"OHndY)S$lS;@+l1QccP>B,3@4UAcb`vdV2$TLalc\bA#(B+#<$! @:)  4 @44144 @j4 @4l @Tk Уef @T $i4 @4n `wy( \ @ yXpxw|xx}Гe @dwгdS5R&Qcg @84Rr$e @4jj|}TgUV67U @TH$ bdgUV67M @N @dL @d4S @4S$"M @U R2wG @U 2&B&m&l&k&j&i&h#o n//"OchCfc?n1\4 4EL `# JrzZ Rbj284244b-g$1 @4UX%404. @ " /4.4-44 4444 @  @52&B&h#o n` (rrL̮Xw\( sdxr x px4xԭ/"OSh5 @(@!2$ @4@TBb"b Bf@ R("TBaQ A (&O h "OCeX%Rb"R BSd&O //"OChci(9:$;1<$d78aQ AG 4&Oi h //"OChSi(H<4V$V$LV$V$=kl6>(3<UDU&U&U&U&U&u<4 @9t$,1L<3$62'1bd&Re BGhh< @4HL^ԃeW6l&Oi h "OcRAtQ!TB$Q$Bb%RT B6 &O ///"OChSjY(:848V$V$V$V$lzUX5De%e%e%e%e%;d @)(935837$2(dce6S CGeE,8W;6X&Oji h//"OChci4 @d5  @4R)67 @U  @4  @444&Oi h`~(~X}}/"OChdT&O h ////"OChcjnP @4Гe @6TH$ @2@1@3 3`Q @4#`c4#`TUFR. @4 TU6  @4 4 @"$2&B&j&i&h#o n /////"OChcin6U5T ` P { @4 dt&4:; DM# r.:h *jjjjjLNjjQb6_Գe @#   Z ,bY%6e @3  Q Q56e @  IF6e @#  @ -b?%6e @3 Ԡ ֠ S7564Գe @ Ġ Ơ Q/6,Գe @#  R'%6$Գe @3  U @4T6UEVe @3  T6eEVe @3 { } U @4 TU6EVԳe @3 eh u`Xu8cГd56e @ JQ{гe6d @ ;> 6TeEV @e +. U @46e @  ꁌ6e @#   @4 @4 4 @d @4$2&B&k&j&i&h#o n //"OChciv84 @Te56 p @47QPie @6 4g @4$"4&Oi hb$ "Ob^ @ &O "OR[ @ &O "O &O ///"Ocin?I @4Tt4Xɠ L `@# 8Z « 8Ѓe3 @6X:9Y @4Od,`X堠.Ѓe) @61UTXI-( @4(%TUL](几d!6e @dQxe6d @R84 @&O8PTDFed ԃe @6UTTEH @4OH$PTTFKd`X4}}ԃe @6 @4hh @4O4 @dOdhЃe @6ꅈ hx @4O33U @4TUEV2#TeEV+S5&c()Уd56e @Rdy%UdUFU @43$-b#`3e @6  @4 @4  @444 @$2&B&k&j&i&h#o n}u`4X4}} ///"Ochn"5%Ci%%7%%%%%ЅU @Td2 @Xe bxdf @$ \ bЃexdf @$ Q bЃexdf @$ F bЃexdf @$ ; bЃexdf @$ 0 bЃexdf @$ % bЃexdf @$  bЃexdf @$  -bdef @$  @d @d 2&B&i&h#o n /////"OCjchn*4$$$$$$$$4kb @[fгe{6d @ w Pe_6d @{ kPZгe6d @{ `PeT6d @{ UPOгe6d @{ JQ Iгe6d @{ >Q"Cгe6d @{ 2Qe={6d @. 'P8de @6 P06 @4,"46UTVGd @U* @4 ' @4(2&B&k&j&i&h#o n //"OChvcd @d @  i @d d @d D  @d"&Oi h `ȯy}~Xzz"OG戔 @6 AC @4 L`P&O "O9l @6 36 @4 L`P&O "O+P @6 %) @4 L`P&O /"OCh  $'2  4ʿ  "ݿ  $ 2f  442&O h zy/"OCh44$$$$$$$$ @4TD"4&O h/"OChT@40V$V$6V$V$V$V$V$V$V$V$V$bt @$ (R;"RBB%mp6 @D @&O h "OdT@40V$V$6V$V$V$V$V$V$V$V$V$bt @$ P@&O /"OChQX50%%bt%(%6%%%%%%% @* BЃdUVVgWRx)Uh2$ @X7X&O h /"OChfdT&O h /"OCh&O hdUE W2#ElR&4 42 /"O'4$G1DNH$NAEd @4DBd5 @,4NC<8 @d&O h /"OCh @dU&O h`s},zLl8zDz///"Ocin 4$$$$$$$ @4 Y @4! cГey 6d @3 X cyГey 6d @3 L csГey 6d @3 @ cmГey 6d @3 4 cgГey 6d @3 ( caГey 6d @3  c[Гey 6d @3  cU 6de @3 T @4 Q @42&B&i&h#o n////"OChn @4$$$$$$$@ 4 @dZ;ez 6d @! ZP5Уe 6d @z OPe/ 6d @z DP*Уe 6d @z 9Pe$ 6d @z .PУe 6d @z #Pe 6d @z P de @6 P @4 4 @2 @42&B&j&i&h#o n`PzXv///"Ochn(5%%3%Ci%%%%5TfT``#1T`Tg2s`3T`Tg4s`5TfPec`6S`75 @44 @X# cЃex6d @5 Z cЃex6d @5 N cЃex6d @5 B c~Ѓex6d @5 6 x=cex6d @5 )"q=cex6d @5 ck=cex6d @5  ce6de @5 c @4 ` @4$2&B&i&h#o n/////"OCjchn(4$$$$$$$LF4 @[He{6d @# jPBгe6d @{ _Pe<6d @{ TP7гe6d @{ IPe16d @{ > Re%+6d @{ 2"Re%%6d @{ &R 6de @!. P5 @426TUEVU @d @4  @4$2&B&k&j&i&h#o ndR &`\zhzX///////"Ocj?nL @J @4O @4QR,P pL<C<:4e @4>c@ @ k A @dl6Гef @dm8d @ed 4ЄQS7$g @(.U @d-- @4e @4"4 @4e @4$ @4 @d @U4 @42&B&m&l&k&j&i&h#o n "ORA @T&O `P r|rwyXXudxpxw$|x/"OCh^ @4QXx(TDt!D^AS24 @U^fR4 @5Y @40&O h ///"OChJꊐN @:xe|dB @U&Oji h /"OCh hxٿd&O h 8 ` ///"OChSj~3A09 @dS!H$/ @d*@EBd,4Be\3We2$,5VgVfr*aVfVgbsVgVfteReVBc32$&q @d&Oji h ///"OChSj~A 9 @dTd ! @dF `t!wX8zuDzwu333333?~sAd4Be\2W"$feb2b"QefRcfedUeVBc32$Sq, @d&Oji h FNpN 1 =N8#*` a1pL0!" # R$ a S` D ///"Och5 ~C<9$yH$  ~C<9$yH$ DzedV @dDUC<: a`TH$Ce Sf `3x `25Fl5X%KSf`2M`1PSf`3`2OFl5X%,Sf`2`1`3 lP6CR QdeP1)@9 Qb#`DB S*?e)C)#d ?f5R$/e)B"/fd^ ) S=dC` #R-dC` QdC`SdJ=e #. @ @  Ci`&Oji h//////"OChSm-@`qXstzMܐN @ kG7$4 @8jdemfiBC4de @7ef^d8 @dl8 @eTQ4DCeKeS`$&Omlkji h //////"OChSm-,(F) @ l!$74 @8kde#fjC4de @7defm @d! @e`$&Omlkji h //"OShci Гe @Bd Гe @d&Oi h`rwwzXpxw///"OChSi @d( @j @eУf @d e @d @j @dgfg @$&Oji h///"OCh$ @:dУf @\}F(12( @"3`&Oji h ///"OChSiQ!+|m @ jvI @J t @ i$df @5e @dm @jk @b%glГdfgZ @(4&Oji h/"OChTH$S @ !dH$b @ (&O h "Oc`sfSgeIGG~ A &O z"O@LN @ >pa!Ai>: @ &O c58WT0 @ د F///L=Slml  //"OCh*T @5i/ !5.HDS6Q B,4ͼ`,&Oi h /"OChb(A`A`A`%&`&O h`  rw`rywXwuxywdxpxp)|xx/"OCh"(A`A`A`56 @T @T;d &O h //"OChSi (A`A`A`惀 @"`&Oi hrzy"O @Sd&O "O}$A`AA`AB`C{ @AT&O "OCeRaQ A &O /"OChR  o @ToT g֌3g @5&O h//"OCh5 a @T` @T` @TaЄU @T 0] @T R @T "TH$N @ "`&Oi h AP "OBUX%JdH$@Sd @5 JdH$CeRn02)S`&O "O7 @BT&O "O4 @BT&O /"OChH2 @TH&O h /"OChH) @TH&O h /"OChH @TH&O h "O @GT&O "O @FT&O "O  @HT&O zrzzzzzzz{/"OCh(A`A`A` @ @ @H`&O hz(</"OChS(A`A`A`P @TN @TM @Td&O hL `L `L `"OI @BT&O "O@ԍ &O "O;Խ &O "O39 @ &O "O޿ &O "O-Ա &O "O( &O "O' @ &O "O޿ &O "O @ &O "O @ &O "O @ &O "O޿ &O $rx#Xzԫ"OА @ &O "OЋ @ &O "O~Ђ @ &O "O޿ &O "Or| @ &O "O &O /"Oti56 @d&O h "O_l @ &O "O[k @ &O "Oؿ &O Pa! ) ///////"OYChsi{?nX 4$ce$$$$$M @d; @d  Q @ded@5b@5\\4H$ CeP3P@5 L-N!^6? @4?=AF @5<7U.0 @41/45 @4+5 @4+ @4 @4d @  n5 @4 N @ @441@|pr`(XPp|s4r40rHLrc<(9b4 @ b 4 @*Q @4]^] @K @4}H @4`G5I\\uf:f%f%f%f%f%f%Df%f%f%f%f%9\d @5d 4 -0+  4+04 +0--"! +2"ed 71ڣkAf.Гg @d *෾  * @ +"J4  && @% @4  @4 @4 P 2&B&m&l&k&j&i&h#o nP`p|{{rTXrsD({/"OShKI%6g7 @H A @J 7<4 @8&O h//////"OChSm3dP 4*p#kH,; 5*$+ @d1d?+ @,4.* @d  гe @d гe @dd @  de<9Уe$f%&'HI @Kd) @H$'~R`hRг4{vwrȱXwܱ@{rr5aa!(>>H486$56$6$ @d7 @d/LH$& @V@OpdvU# @5$4 @e @dH @4H" @4 @d @  @ 0,4 @=H  @4h&Omlkji hP`?hp xssqs,zXXqV}s//////"OCjcisl?nRSd@1 @3iCf`2 `1 N@3hFl4H$?Cf`3;`2֠ Cf`1 `3-Fl4H$(Cf`3$`2 `1M@6Il4 4$ DM# J t,Z>&0   HA5 @4d     @e   f @e dX P\劐J @5ui |K4BUX%@ @eAHBA<5 @dSd ˺d\h< @5 Q  <8ԓfg @e H/C4/5 @<40d d .Гf+g @e !aa! dd3#yF  s  @ d @~C<<: e @dd `d\ $|5 @d꺳d K D `hqL{X{d{XLһ  ' \ۻd VeO)L`9,DAf @4"d HQCY5 @<4d  d hMxSԮ ? @Ufs<6TWb$QS6R';Й5 @ kI @d T?ծ:; @ѡ , @4d>: @  .8 @d*Ӛd# @44d4 @  $3 @d#Ӈd @4d+ @   @dtd @4 d! @  C @dad\`h|p{ p rXs LLлX|{sT] @4dm\ @  ^Z @dbdTx @dVdc @  TS @dXdB#!hHT @ed[ @ hYOf @eJ~GAq<|eT^OeT\M.IVW @e f<)L0),YeA @g 0aa! )2I<9 @dEdڠ)' b,b("Ӡ )79 @d3d)%< @4<* @4<" @4 0c @ 2 @dh2 @ h61 @e %Гfg @d `?2&B&l&k&j&i&h#o n /"OCh04 V$V$V$V$V$V$V$V$ Ls7Nr'> H4 @  @dP0&O h\ {`}HvLX{XXsXsz//"OChSi04 V$V$V$V$V$V$V$V$) Ls7Nr'E{)>H9 @4 ?86 @dP0&Oi h /"OCh30W4 f$f$X%f$f$f$f$f$f$'>Hij  @4 %#! @d0&O h ////"OChSkcjsiEd\44E\464Գfg @e Ѓe ҳf"dg @&Okji h\}{(X4s////"OChSkcjsiEd\44E\464nhԳfg @ecЃecҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464WQԳfg @eLЃeNҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464@:Գfg @e5Ѓe8ҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464)#Գfg @eЃe#ҳf"dg @&Okji h ////"OChSkcjsiEd\44E\464 Գfg @eЃe ҳf"dg @&Okji h{XBeSVh&b$BeRUX% R$QVcQ5ceb$aVSQ`1b$ BePaa!QS1SP3SR"$BfbVh&ceSVh& R$QVbR 5b$ceaVb$ CVbQbWx'AAS1Ra4 AWrQ4|5b%cB aBVcQcWx'AAS1Ra4 AW sQ4|5b%bC a//"OChSi(f`8XUSd@c . @e dГe @ddC`&Oi h`qdX///"OSh @ i) @d0jd`&Oji h`qqX///"OCh @ hЌ9 @d @4~Ad @4Ѓd @,4j<: Уi @dЃd @4`&Oji h,d@0q,L/"OChЃd @4d @,4 Ѓd @<4~ Ad @4h @4 @d&O h,d@rhl/"OCh @ TH$ @ TH$ @ &O hr$D`G#`F3`E C` #`"$B"# C`/"OCh#`"("TH$ @ #&O h //"OChi @d, @4`&Oi hq/"OCh @T, @4 @d&O hrr//"OChi @d @48 @4`&Oi hXq/"OCh8 @4 @4 @d&O hr/"OCh @4 @d&O hr//"OCh @d @4$9 @d`&Oi hq"O @ &O r//"OChSi @ ) @d`&Oi h\s//"OChydUH5,E5aAdA @4 dAVBeu`5BeBVX6g4:uf @$Km=72pgKm=fu @4; RS&37,7rc<6vh&cjd! @DiUT,Vb2BBl,<7pgFl @TdC @ &O h/"OCh6 @Td: @ &O h//"OChSi0ce @4deVR("h4* @AT`&Oi h /////"OChSickndl @TZ:4 @DlУfF @dЁRdf @"eгe @dIdS2e @5 ЁQ @dR"SQP&Olkji h`[Hs @d;e @ne.^ 6e @8U @d j2 @dZeJ fgdm-Уe @d-' @dEe5 @"F @4b-b#`tG=CeVE\6b2\2"a!`cMd74[PX%T<=cGB$o,bH3<Գ2 /"OChX QdeUEdQd&O h/"OChD d5a5dƾSCaЃd>3&&O h/"OChY @tV(A`A`A`⃀"`&O h "OK$A`AA`AB`CA @t&O //"OChTH$ @2 @1@3!3 S8#/-$ a!4$" 4e. @4 $ & @4 & @4  @4&Oi h //"OShBUX% P2P15P3O\ DTUP4W4)DtQC`H d eP4W4)DtCC`|,$D}PԷDUETTEUTVG5 @4  5 @4dDtC` @tix @de @d &Oi h "OBVRQ6$h& `1 `3`2 DRTS02)H bX c02 )lu @t zu @t &O /"OChRTH$B@3@2 @1@3@2TR$TTUUD UX b#`Yu @4`&O h/"OCgShrT4> L `# 8Jr` jtVSЃdG @cg+ x gx'EdEՃdK @sf wHЃdrfA @qW Aw @sd>fA @d : @d <: @d&O h"OBT4>L# &4BPv^ lSd(1 @ / %Sd. @ ( Sd! @ ! Sd @  Sd @  Sd @ Sd @  Sd @ &O htP}P\} $(0d<X//"OChx?nQP1Π X%Sd @2 @15@3@2q@1n TH$@2@1 e- @4 #*ՄV @4 "T@U @65 @4㋠2TH$@3@2 e @4 ЄU @4UdTE @4e  @4TeDU]2|(r; @TQ!S8#'x3 @df)OM5 @4J/1 @5 )4x @df95 @44$( @5+,?&Oi h /"OChSdcesfWX( H &O h"OcgEVh&Sd Fse&O  (r|pпytXszz"O`5!Sd @ce@&O /"OCht$(A`A`A` @4,45 @= 4 $B#`BA#`BB#`C`8&O hPt`|]////"OCh(A`A`A`Z[9 z:aa Ad dUH5\@PAtBD(E,FFDG(IIJ@KLLGhMM3l4N3DO 4PX4DPPQ|2R4R5e`55d!!!#!!%')+-/ NB @,4`&Okji hSSTThTTUYWXVZqRRR S////"OCh[ (B#`B#`B#`PNCj<4 @:yUТeTX4 @0d4 dF @<4i[jz:c2c Cd CjT @4 e7Wd @j_:Yk{;aa Ad dUH5R @4 +УfU @4* @44 @T& @4 # 4 @42&B&l&k&j&i&h#o n///"OjydUH5,E5 aAdA @4d @ Уde @V&Oji h(r@ D9 @4m34 @De+MDf @4Pt (4 @UfUdc1S C5-t @4$ @T 4'D5 @40+UV @4Ucf1Sd C5# @4W PaAH$EB@3=@2 @1=  @47 D3E@\|ctsX` ,d$\h\Xc\3`؁$UadQf A5 yP4Be @AV֮ P;yb2E @4D @4`z,?&Olkji h/////"OChglh&TVUH6$,FvFl5 @dTH$@3@2@1 @  Rr$ aqa` f 4 @5TUDUbf!Re Bd&Oji h"},?///"OChqQЃjTUQH5BTVUH6@,FvFl5 @dTH$@3@2@137 @  Rr$ aqa` 0f*4 @5TUDUbf!Re Bd&Oji h //"OCh\.Ar&ic93S CeTUH5,ETuE\4 @eUTQX4@2RU !"t4"}TPTRH2T @44&Okji h/"OChaq3 @447|9A8de @V(Ѓd @5* @4& @44&O h "OCfL3Bnqcebc3S C,5&O ///"OChSArj:&ya1 aLQCed A<5 &Oji ha"4bXc0//"OCh<4r&Jr5 @$LAe5FC"i<9ab"R BdTSH3CHS3s2)&Oi h //"OChL^Ar&ic93S CeR$02*b,dH$5'' @ RD&%@<8 @d&Oi h 4Nqp&  ///"OCh$LqBcj3S,: Ceb\#RAi9d Beec2S CdaeQ Ad&Oji hl"0ld//"OCh\ᦐAr&ic93S CeNTUH5,ETuE\4 @eTUQH5 'l5vd @.g>e @d>0.C3`C3`C3`5 @dR 7ТeTX4 @( dDH$Cid(&G @f$Тde @ch kd# @eСU({d @f]lk(|<aa Ad ТlT( @4 e(Wd @*(<8(2&B&m&l&k&j&i&h#o noP\p]_t}///////"OChSmclnTQ4%H$L5> @ Q< qde @V75 'l5vd @.g4e @d1 @dJ eTX4@AB89:uzmntklYWf[]<DL,9B)l{FIDZN.Nb<v commctrl.dllCOREDLL.dllAYGSHELL.dllIMGDECMP.DLLVariantClearVariantInit"SysAllocString_VarDateFromUdateVarUdateFromDate$SysAllocStringLenOLEAUT32.dllCLSIDFromStringCoCreateInstanceole32.dllA")8?E=: da!$"#  ITbMLZFGvwxqVBRvUu"3P  $#4yYAHkl9A_M;?=>@AB89:uzmntklYWf[]<DL,9B)l{FIDZN.Nb<v 8R8L̬X"&'OP Ff(D3&! IZ UBb|((D)* DADALRTPP8PP8PPPSLSQpPHQQhBDM&<'l222P323(3h''##$H$x$$%4%d%%%%$&T&(,+T+//(.+--jllllH,,Xedc0cl`B 99 iL-,t=&&LELFJIXI|LTFH`H>H>IIB@C\CCQp6P76L86|7877$0H0#l009PCbb T4T|; 0L1343d554<64D45t?H??>=l$m8mmpQlbb pppq4q`qqsrq@LttDuuu`vv(nwwkLxxxy|yyyy@zzzP{{{8|@|lM8NPd}0~YZEiĉ@L P|ܗR,ԘX< ؝lgfQ`Ѐ $ \%s\%s.dll\windows\%s.dll\%s.dllAll Documents (*.*)|*.*||%s|%sAll Documents (*.*)|*.*||%sopenfile:PegHelp.exe.app\*.*\openSysListView32EraseDelete File.app\*.*FriendlyNamePort\Comm\IrDAIndex\Drivers\Builtin\IrCOMMFriendlyName\Drivers\BuiltIn\SerialCOM%d:COM%d:COM%d:ErrorSHCreateMenuBar FailedEDIT %%.%dfError CreateCtrlWindow ID 0 and 1 are reserved for MainWindow and Console WIndowError CreateCtrlWindow ID 0 and 1 are reserved for MainWindow and Console WIndowPlease Register PocketC|0|ALERTCONFIRMDEMORegister PocketC!DEMORegister PocketC!^|, Database ErrorUnsupport Database Value Type\temp\%d_%d.tmp%s: Unknown name or named argument.%s: Incorrect number of arguments.%s: Error %d: <<No Description>>%s: method or property not found.%s: Overflow while coercing argument values.%s: Object implementation does not support named arguments.%s: The locale ID is unknown.%s: Missing a required parameter.%s: Argument not found, argument %d.%s: Type mismatch, argument %d.%s: Unknown error occured.COM ERRORMemberCOMInvokeDllRegisterServerPalm PCHPCJupiterEventPenEventCharEventMsg\pcshellv2.exeErrorPocketCv3 runtime cannot be renamed to be PocktCV2 runtimeopenCannot find PocketCv2.exe runtimeGo get the PocketC runtime installer from http://www.orbworks.comPocketCrtPocketCrtPOCKETC_MAINErrorFailed to Create ControlEDITBUTTONCOMBOBOXLISTBOXSCROLLBARSTATICErrorSHCreateMenuBar FailedErrorSHCreateMenuBar FailedErrorHide SIP Button Failedout of memory,V,,,V,,,,V,VVVVVV,V,V,V,,,V,,,,,,,,,V,,,,,,,,V,,V,VV,V,V,V,,,,V,,,,,,,V,,,,,,,V,,,,V,VVVVVV,V,,VV,V,V,V,VVV,VVVVVVVVVVVV,VVVVVVV,VVVVVVV,VVVVVV,V,,,V,,,,V,VVVVVV,V,V,V,V,,,V,,,,V,VVVVVV,V,V,V,V,,,V,,,,V,VVVVVV,V,V,V%%%,,,444<<<DDDMMMVVV___iiirrr}}}Թ (8LXdp|ĺ̺Ժܺ $0<DTdlx̻Իܻ4Ll|ļԼ 0CIntCCharCFloatCStringToIntToCharToFloatToStringLoadSaveArrayIncADecAIncBDecBAddSubMultDivModNegNotAndOrEqNEqLTLTEGTGTEJmpJmpZJmpNZRetSetRetSetRet0PopPopNLinkUnLinkHaltSwapBAndBOrBNotSLSRXorWordPFPRelativeCallRelativeStackCallDirectCallDirectStackCallDupTopDupTopBlockLibraryCallLoadNSaveNEqBlockStackToGlobalStackInitStaticLibCallInvalidInvalid^|, ---Unable to LoadImageUnable to get DC "CreateDIBSection failed\n""Unable to create palette\n""Unable to CreateDIBSection\n""Unable to create compatible DC's\n"%d (%xh)%c (%dd)(%dd)%f%sNonevtStackIndexvtAddrvtIntvtCharvtFloatvtStringvtVoidvtNone%dThis program requires %s dynamic link library (DLL) The library found is not a PocketC compatible DLL library.This program requires %s dynamic link library (DLL) Please place this dll in the same directory.LibraryCallLibraryInitIncompatible LibraryMissing componentPocketC RuntimeOut of Memory !!!\temp\%d_%d.tmpruntime error at %d %smissing string resourceAttempt to increment stringAttempt to decrement stringAttempt to increment stringAttempt to decrement stringAttempt to subtract stringAttempt to multiply stringAttempt to divide stringAttempt to mod floatAttempt to divide stringAttempt to negate stringtoo many argumentsStack corruption in vmRetStack corruption in vmUnLinkAttempt to&floatsAttempt to&stringsAttempt to|floatsAttempt to|stringsAttempt to^floatsAttempt to^stringsAttempt to<<floatsAttempt to<<stringsAttempt to>>floatsAttempt to>>stringsAttempt to ~ floatAttempt to ~ string  0O">4H,@N;T  p -  $ X  #4 !x &   :|  ]hB R  L8\L$`#>P)@l J|#^    N - -\.&8/ @XD uCp 5 !8! !n""".D# `# x####$H$x$$.%4%d%%%%$&T&&&&$<'h'.'\|((-)4)*:T+:++(,H,#, 4,*L-,--#(. k/ N/D$0H0l000LL1 l2 2223(3P3x3332D4!444Ad5 556<6p6 667 P7|77RL8 888 91949 |;mX<t===,>H>2>&> ?H?t? .?$@@@6A gA& BLE>EFTF'F H.`H)H)I'XI/IIJ hK |L!L'M $M#lM#MB8NtNNNNO<O;P P8PTPpP P.P PQHQpQQQQQ R $R 8R LR4R LLSSSSSS T4T\T%T(T&DUPU>U[VN W xX QY Z H\ d] e]b^ N<_ `_8l` =`!,aFaaab)lb bbb20cKc jd^XeSf g-lg i hi qj |k Q\l Bl$m 8mAm5(n Zn pBp/pq4q`qqqr&sLtAt9Du6u#u4`v*vww(Lx9xxy6|yyyy+@z.z,z.P{+{#{$8|B|Sd}f0~h~~ c` 8Ѐ  $  d 3('xW( hLT ĉ i 4 $ 8 L @ P -HD|7$#l7ܗ  8)$Ԙ ,  4l) $Icȡ` W C"ܤ8L%<Dl/̦ #,H,T h 7X  ܩ$ 8 L$:\ p     ԫ    $ 8 L"   ̬   0 D X xİ  8\=l1л BT - -  -h -Ľ >@t#$p 2h *X> (d*>420l,h 6 &l&T `$4l . @ ,P6  (44$@ \ f6$X(  ,8h  d ` H, 2/Dh H ,L h! D&&w"8x,  $P<*@+80%|#3,A  6T44d0p ! "P!8!|!.!`!!!,!p  +$Lx ( <\| Z.,t+ 0,h.*D8, 8 ` :;;8.P4l  ,P h (   ` | *$/ Y8 w(8#  9p (< flM j  ]0 p@  \  x  #X  # .<### M>8XMPu<0.LxD* <}8`BpP: C8dT' | Nh @ g!1" 4" H" \" p" " " " "\%y& & & & &&=t' ' 'z(V<)p). 0 12D2|2 33 4X4;450`555% 6P6TT7 81@9 D:;<=q>\@yPAtBD(E,F0FEGEG (IWI\JX@K`LXL[hM0M54N5NN N O DO ]P"DP@P FPQaRDR-R S8S1S/hT8TwUVwWXyYiZ(Z$([`["[&[$\"h\"\$\*H]|]]]&0^d^^^_4_h__"_(0`d`` ` a :a <a4b*bb,cXcc 8d5) return 0; else return cc(n-coins[i], i)+ cc(n, i+1); } main() { int n; int s; n=gets("Enter a number"); s=ticks(); coins[0] = 50; coins[1] = 20; coins[2] = 10; coins[3] = 5; coins[4] = 2; coins[5] = 1; putsl("cc("+n+")="+cc(n,0)); putsl((ticks()-s)/1000.0 +" sec. "); graph_off(); } int depth; fib(int n) { if (n <= 2) return 1; else return (fib(n-1) + fib(n-2)); } main() { int i; for (i=0;i<40;i++) putsl(fib(i)); }MZ@ !L!This program cannot be run in DOS mode. $E}}}]}}H}}}\}Rich}PE";! ( \p(4'`*$.textx `.rdata@@.data2 @.pdata'4(@@.edata\D@@.reloc*`,F@B/"OCh @@ (:`&O h "O @  &O /"OChB @d JdH$eR(C`&O h//"OChSid @eEu4 Гe @TS2(&Oi h /"OChX%de`B( Qz @4T`UB(Q&O h /"OChX%rde`B( Ql @4T`UB(Q&O h //"OTCchsiPT\ @7tG9 2342L2 bC`@%D&Oi h//"OTCchsiPTI @7tG9 2342L2 bC`@%D&Oi hA4ZC3 t M`C` ///"OCha0 @d xad- 4xad+04xb-d0045xb-`xb-dX04*xb @-d ada#0adf2aId @I c=csb-d 3<9ׯ )` @ b c-b r=d,9(4@LXdp*ddC`&Oji h///"OCha @d xad- 4xad+04xb-d0048xb-`xb-dX04-xb @-d a @da#0a @df2aIvd @I c=csbu @-d 3<9ԯ `k @ bc-b r=d,9*ddC`&Oji h /"OCh[ @ x`A8F3 xha#8f1x`&O h///////"OHSjchsinC @d 4A @DeB @4G:fdfeB.QfdB @4dC @e? @4d1 @el/e @m8 @ j,0-.,,-*-+ @d &tde @F  dgde @F e @le @{ͯmR`$Edfg @h @d @4` 2&B&m&l&k&j&i&h#o n|(4F1 //"OChSi?EЄ @4JГe @4F\ @4 d1(B!$5 @di,?&Oi h"OH$/ @ &O "OH$. @ &O "OH$)X%H$X%% @ h&X%  @   @ &O "OH$)X%H$X% @ h&X% @  @ &O ( H$  H$  /"OCh(A`A`A` @  d  @dA`&O h ///"OChSj^(A`A`A`Y @  iT @deUУf @ddA`&Oji h ///"OChH(A`A`A`惀F @4A @  jC @4d: @ i? @4f8Гe @dd8A @4`&Oji h ,$A`AA`AB`CQVvbbr"&QS1 C`//"OChSi(A`A`A` @  d @edA`&Oi h "O$A`AA`AB`CAUuRbr(""%ATH$ @&O ( 0P   ///"OChSiZP 4 @deГf @d Bbr"$ @  j @deГf @ddA`&Oji h ///"OCh @4YP4 @4d @ j @4fУe @d Bbr"$ @  j @4d @ i @4fГe @ddA @4`&Oji h "OS`5s&O "O^`5e&O //"OChSiTtBaq$TtBbr(""$TH$g @R`!&Oi h///"OChSj[ @TRT!RT,4t @Di[ЁS2e @dTСQd @eMЁR @"dS#TtBaR!R,1$S&Oji h/"OCh14d¿eϾ4&O h /"OChK4de佾4&O h /"OChS`45de䥾4&O h /"OCh^`45de䍾4&O h "OATQUAQQR 1Re_Bd )&O //"OChSidQQ1QeFd )&Oi h(  H 0P   /"OCh @4 @4deO @4O `&O h //"OChSi QQ0Qde )&Oi h /"OShCe @4 @4eտdO @4O `&O h"OATQUAQQR 1ReüBd :`&O "OAQd :`&O /"OCh @4 @4eQd :`O @4O `&O h "OQQe :`&O /"OShCer @4r @4Qdpe :`Ok @4O `&O h"OAQQR"eYdcC)&O "OARct?W4 @6塐5,?&O "OARct?哐5,?&O ///"OChSjcii4e4e4d5(4`&Oji h ///"OChSjciG4e4eC4dϼ54`&Oji h ///"OChSjci%4eS4e۽4d54`&Oji h ///"OChSjci4e4e)4d5¼4`&Oji h  P   ///"OChSjciӻ4e_4e4d[5䒼4`&Oji h ///"OChSjci䱻4eK4e4d95p4`&Oji h ///"OChSjci䏻4e4eE4d5N4`&Oji h ///"OChSjcim4e4e{4d5,4`&Oji h ///"OChSjciK4eɼ4e4dӻ5 4`&Oji h /"OShcg`&O h/"OShcgCfaQcdVx6`&O h////"OChSkcjsi4 @De @4 @4QdJefF @5 @4I5 @4de @4`&Okji h AQ ` "O @ &O AQQ! L`/"OChTH$ @ 1Qa1!&O h"Ona @f&O "O @ &O /"OChy @4z @4eQ?dhu @4`&O h "OAQ/d&O /"OChf @4g @4eUЁQ @dhb @4`&O h"OMAQ @d&O /"OChL @TdN @ &O h/"OChD @TdD @ &O h/"OCh< @Td9 @ &O h//"OChSi:ce @4; @4de fh6 @4`&Oi h /////"OChSickhdl @TZ:4 @DlУfF @dЁRdf @"eгe @dIdS2e @5 ЁQ @dR"SQP&Olkji h$0 F<HT1P      //"OChSiU`1PeS`d2Fe1WD`$@`%6u @deo6$&Oi h/"OChFg1tDgs`@`dc`6V&O h///"OCh @Tjb @-d zTBeP: УcAYX3!C89Sd6F @eQ&Oji h///"OCh @Tjb-dH$ y @ )iz)1)Qb(9!I&Oji h /////"OCiSjclj @dkb4 @Dh`@EgЄfg @ef diV @d`&Olkji h/"OChTAWw6[FBd @l4 dR"b(4!DC`&O h //"OChciCe`1`fc`T2>FeWD`$@`%1>6u @df5$&Oi h"O2fg1tdgs```S`5&O /"OCh*e`1`fc`T2&FeWD`$@`%16u @d e$&O h/"OChЁQ @d dQa4!DC`&O h`lx4  ( 04////"OCiSj @dk4 @Dh`@EЄfg @e di @d`&Okji h/"OChЁQ @d dQa4!DC`&O hAQ P AQ ` /"OCh @ 0 @d&O h //"OTCevns5 @44 74m @4g @4h4h&4e @4_ @4`2&B&h#o n///"OChn  %Se @4Q5 @4娰4 4B04H @4B @4`2&B&i&h#o n ///"OChnf  %3e @435 @4l4 䭱4$0䰰4* @4$ @4`2&B&i&h#o n /"OCha 1d @d&O h"OBd7 @$P&O /"OchBd7 @$`&O h`l8   4 h ///"OChSjY  Cdd9$H$"(@2@1    #B(* B(* 䫾4@B%de @vd 4B(&Oji h/"OChd4 @ (&O h Ba 1  "OBd4t @&O "OcgBd4k @&O "OBd4f @5&O "OBd4^ @ &O "ORActT5&O "OcRAtT 5&O /"OChSd5`TUB(Q&O h"OT5&O /////"OChSl,1d @jy:`@d׿=e ;`&Olkji h"O]`5渾&O //"OChSi)  @dfdeF &Oi h"OO5慾O `&O "O5v `&O @("O5VP&O @aaA,b 1 a)B 1)# :`@aaAB 1 a),b 1)# :`/"OChڿ  濃d &O h //"OCh߾ di9`&Oi h "Op @t&O "Ok @t&O "OC`Sded @u&O Y IP"O^ @t&O "OC`SdeW @u&O HP X/"OChtݹ4&O h"O@ @t&O ////"OCjchsinA6Ut @ee8 @4z:5 @de9 @4 &+ @4. @4 5- @4䗼4j:jz4e%Уf @dJ`5 @42&B&j&i&h#o n "OCfBdH$ @&O $A`AA`BA`C! C`Ї ` H  4/"OCh(A`A`A`TH$ @ 1&O h  //"OChSi @4U @4eӽ4 @4 @4&Oi h //"OChSi @4U @4廓de4㻓de4{ @4 @4&Oi h //"OChSit @4qU @4e4j @4n @4&Oi h //"OChSic @4`U @44)Z @4] @4&Oi h //"OChSiR @4OU @44)I @4L @4&Oi h ///"OCiShn@ @d=БU @dܽdiI44e @ fU+d 7U @d- @T, @d1 @d Q!& @T% @d* @d 2&B&i&h#o n QAP DQTR 1 ) DQTR2 ) /"OCh @t @4( 5 @4(A`A`A`df`&O h     h  /"OCh(A`A`A`( @4 @4x @d&O h //"OChSiQ}tu @R({Ќ4#S1Q(5 @RsЌ45 @)S=&Oi h /"OChn @t^(#4 @g4 @)=&O h "O^ @(t&O /"OCh[ @ G @dS7C @d&O h CeP1 P3 P2 P1 P3E@2      4 L#  $- , , + + + ///"OChSjci @(t: (xУe @de @d&Oji h /"OChҾ 8 @4(A`A`A``&O h 7 0 @ WX /"OCh!(A`A`A`8 @4d&O h //"OChSiо 8x8ye @d&Oi h /"OCh (A`A`A``&O h,@"O$A`AA`AB`C &O //"OChSi ed&Oi h"O &O "Ov &O DQTR 1 ) /"OCh 8x @d&O h/"OSChdu(68t @5e @48x5 @de @4 &O h//"OTChcivz,68t @5e| @4q8x5 @deu @4  s @4d 5&Oi h /"OSChdua(68t @5ed @48xX5 @de] @4 \ @4pP&O h////"OChSjcinE @5eM @4 L5 @4d=e @deC @4 * @ @4d 5߯z 2&B&j&i&h#o n ////"OChSiP38* @4 `(4{ @d0"8 @4e @d86e4 гe @dj @4d"eܯ ;43 { @d0* гe @dj @dde \ ,\D eidH&Okji h/"OCh` (A`A`A`,b"3`45`&O hP"Ok$A`AA`AB`Ce &O RB` 5LBQZA6 ,b"`L VQRR"TS4\ a`LTVUUd U TDQ %BQRR 1 ) /"OChC5t @ >S71&O h /"OCh$ QdreU#dd&O h/"OCh d5a5dSC$Ѓd>&&O h/"OCh @t @45 @4, @48 @4D @4(A`A`A`H ()ƒ`&O h,"t! <dTP/"OCh(A`A`A`D @48 @4, @4 @4 @4x @d&O h //"OChSiDu @DtL5 @45 @45 @4T,&,5 @4I(H(I)H)&Oi h //"OSh @DtiDx @de @d &Oi h/"OCh @tx @dp&O h//"OChSity @4xx5 @ded&Oi h"On @t&O MP 2 - //"OTChevf @tiY8x$5 @d `&Oi h //"OChSiZ @t xX @ddne&Oi h/"OChN @t xF @d&O h//"OChSi<6 @5e/ @43Ѓd @5e< @4 ' @4di 5&Oi h ////"OChSjcin' @ :]d @5e @4 5 @4de @de @4 < @4R2 5$d18!`|P"  !c! \!܁!`! 2&B&j&i&h#o n////"OChSjcin @ :,d @5e @4 5 @4de @de @4  @4R2 4B) 2&B&j&i&h#o n ///"OChSin @ 9+d @5e @4 5 @4de @de @4 } @4R2 4C` 2&B&i&h#o n ////"OChnq @5ek @4 j5 @4dje @den @4 _ @4 9d @d  d :zۯ ` 2&B&j&i&h#o n////"OChnJ @5eU @4 T5 @4dDe @deJ @4 J @4 9B @d Źd :zۯ ` 2&B&j&i&h#o n"OBt&O "O:t&O "Oؾt&O "Ot&O "OTt&O "OLt&O "O @t&O ////"OChSk @tj @di @dg xef @d&Okji h\8!| e  ,D܁"OCePz^&O /"OChj dPF&O h /"OCh @DtH8” @4H ™ @4 @4 @4H()&O h//"OCht @i y @49Tt4dһ5Q8|Ќ45 @eŻd &Oi h"OC`Sdex @u&O P N /"OChi @tf(A`A`A`僀_ @d`&O h "OZ$A`AA`AB`C\ @t&O //"OChM @  d@2 @1@3!3 S8#/-$ a!4$" MeH @4 $ C @4 4 @4 ; @4&Oi h//"OCiSh$ @  d@2@1@3`n TUP4W4)DtcC` e d@5G5)DtUC`ДTUDUTUVG5 @4   5 @4dDt8C`(#, 0 (X P",    c8X,"y @dix @de @d &Oi h "OBVRQ6$h& `1 `3`2 DRTS02)H bX c02 )wu @t iu @t &O /"OChRTH$B@3@2 @1@3@2TR$TTUUD UX b#`[u @4`&O h/"OCgShrT4> L `# 8Jr` jtVDЃdS @cg+ x gx':d9Ճd< @sf w9Ѓdrf6 @qW Dw @sd2f2 @d = @d -. @d&O h"OBT4>L# &4BPv^ lSd+$ @ / (Sd! @ ( Sd$ @ ! !Sd @  Sd @  Sd @ Sd @  Sd @ &O PdppxH   X,<//"OCh?nQP1 X%Sd @2 @1<@3 @2| @1w Ġ 0 @d d@2@1 e0 @4 (%ՄV @4 )@TU @6#5 @4㖠2 @d d@3@2 e @4 ЄU @4UdTE @4e  @4TeDUe2|, DP p , d8 @dd@2@1@3 c44 @4d/ @ d0 @4dD)% @d d@1@3 S=c3`! @4  @4d @4 dC`" 2&B&h#o n/"OCh @t (A`A`A`⃀#$%`&O h, \h 4,t"O}$A`AA`BA`C#$%| @t&O //"OChSizu @tQR$S5&Oi h "Ok @CT&O //"OChlt @dd @  d_ @`&Oi h//"OCh?^ @tdW @ 4K VfIVgb$qVgVfrct VgVfr$aVfbTfc`LP`M?4VgIVfr$aVgVfrctTf`$PeS`ATH$#77 @ 46 @TQ!S8#'x9 @df5OM5 @4J1+ @5 /4x @df*95 @44&$ @5+,?&Oi h /"OChSdcesfWX( H &O h"OcgEVh&Sd Fse&O           `"O`5$Sd @ce@&O "O @ &O "O@a`@a`$ @ &O "O @ &O "OԿ &O H`%$>22H "O @ &O "O@a`@a`$ @ &O "O @ &O "OԿ &O H0>2&@//"On?bf @d ` OXЩ(eЃd @5  bT45d @-R2 ]05d @" YM,5d @;K T(5d @*2 PG$5d @E" K 5d @8 G@5d @'>2 B5d @" >:5d @58  95d @$2 53 5d @2 " 05d @2  ,-5d @!+2 'Ѓde @.) " O&Ѓd=! @5 O"Ѓd< @52 OЃd; @5" O5d3:LT`ht2|%%$4r @ E OpЃd9m @5F㰕O2 q8iЃd @5ⲕO" m7dЃd @5=᧕O T6_Ѓd @5B㜕O2 P5ZЃd @5>⑕O" L4UЃd @5?ᅕO H3PЃd @5@yO2 D2KЃd @5AnO" @1FЃd @5CR O<}u0AЃd @5WO2 8/<Ѓd @5HR O5pu.7Ѓd @5IR O1ku-2Ѓd @5JR O-fu,-Ѓd @5K/OR +au#5 @d'O*d * @5#Od2 ) @5" 85d @> O 5d8'\l|&%DPTX@\8Ln @ x2 Od&i @5_ҵO" %eЃd @5[ѱO $`Ѓd @5WӦO2 #[Ѓd @5SқO" G"VЃd @5OѐO !!QЃd @5KӅO2 " LЃd @5G" #O|GЃd @5C $OxBЃd @5?2 %Ot=Ѓd @5<" &Op8Ѓd @58 'Ol3Ѓd @542 (Oh.Ѓd @50" )Od)Ѓd @5, *O`$Ѓd @5(2 +O\Ѓd @5$" ,OXЃd @5  -OTЃd @52 .OPЃd @5" 1/dhlptx|&`OjLd @5lO 0eHd @5hO2 1`Dd @5dO" 2[@d @5`3 W<5d @/\2 S485d @Y5" N45d @=V J605d @,S72 E,5d @O" A8(5d @:L9 <$5d @)H2 8: 5d @E;" 35d @7A /<5d @&>L2 *5d @;" &M5d @48 <2&B&h#o n///"OChSj1 @4d* @,4Ѓd% @<4(A`A`A`drЃi,9e @d @d6`&Oji hX\hP|&x    ,(0/"OChS @4UЃd @,4dP @<4M(A`A`A`d&`&O h //"OCh@ (Bs#`B#`B#`i92dd9 @4_,89 @d7 @d&Oi h /////"OChSlL'Ќ;F @d+ @d Ơ B#:z6̠# @d0 @d(8(ྠ @d\  @d @dtL1bB a,1 @dn L1bB U,1X\hPx|x    @drL1bB /,1 @d\L1bB\#,1{ @d"L1bB",1u @d'L1bB' ,1o @d0L1bB,1%1!i @dxf @dXa @d_Ѓd @d_ @ )I]Ѓd @IdZ @ )L0aAzS @d> P @dL1bB,1z3!L0bB5b 2"zp6&Olkji h/"OCh>Qd @Md S1dM` ks6Q2"aQdM`/Q `/Q `$Q321dMdH$эaR!dM` ʯ S1dM`/:S1 `*5S<2"1c,32!bQdMdH$S1dM`*S1 `/S1dM` s6Q2"aQ `/Q32a<11c&O hdh4 BQe]`/BQ `/BQ `$BQ321e]eX%aBR!e]` BS1e]`/:BS1 `*5BS<2"1c,32!bBQe]eX%BS1e]`*BS1 `/BS1e]` Ns6BQ2"aBQ `/BQ32a<11c ///"OChgj:Ld "dd id  ;d  d M头dAs6`&Oji h ////"OChSi*Ѿ '41L;S1dM` S1dM` Q`d@z:E Q321dMdH$a2d dhxJ`Lx WГd @e&Okji h ///"OChF@ @ tMЃd @dC{ @  G @d_E @d#fB @d#6 @ddC`< @d !: @dYd0 @  5 @d_( @d 3aA3z :ߏ#Aq5i:<9 0bBd5 xГd) @6 @5e @4 @5e @4  @4Uɳd &Oji hhx%4&d2   //"OChQdMdH$d<4BUX% L9 @RdϽ")心d 8L傳d&Oi hhPX////"OCh@ @ tQd @Md  S1dM`0S1 d @ xS<2"1`,32!b-dC`QdMdH$csS1d @Md R!dM`.nЂR!d @Mde*MiЂS1d @Mda0EeЂS1d @Mdf1=S1dM`.*^ЂQd @MdeZЂQd @MdeQ `- * R,32!b-db 0ByES<11c=dc Cy9 0EAC6& 0I+5 it<9ʲdòd : xe @4TUB)Q4 x @d)&Okji h //"OChQ2"ai464#DM# $DjjD<jjjjjjjjjjLCe:P29 R,32>8d<6!b8<8.1dR!dM`&.,8&'dQ'2"<8d'aR!dM`|,8:dQ2"<8d( a ,88d8d9  h"09d,4d4 e0d &Oi h/"OChp&p 4O @ d İ4"&O h//"OChSi}Fpd 4 5A @ tppFpVpppVpF&Oi h /"OChX3 @4U&pd 到 4Pp 8+Ѓd @&O h /"OCh" @ :p&pd h 4/8d @"&O h "OCfbd @bV &O "OCQSR 1Re @Bd &O \dhPxH  ? X///"OChSj. @dQ1/ @di( @df'Гe @d &Oji h CQP1 )S` S "OtcRA\5 @4@&O /"OCh @ d5 @4 (B#`B#`B#``&O hXE',/"OCh_(A`A`A`dZ @,4ʸd&O h//"OChSi`T4U$U$U$U$GU$U$U$U$U$PPf5f%f%f%f%f%Df%f%f%f%f%Be @4t8?5 @dT&Oi h //////"OChm^= SdW&3`X4U$U$FU$U$U$U$U$& @4b!R Bd w ) d@2&@1:@3Xg d aX6V&V&V&V&DV&V&V&V&V&V& fe @4 H d ? dh( H,(d +aQ Adܾd  վd df05  ľd z彾d z*遯 7 @4X&Omlkji h ///"OShJ?CjF=:%Тd @U$> @4iDyT@9@f @4Ѓd @5 ",?&Oji h/"OCh @ d @4 (B#`B#`B#``&O ht D   F/"OCh(A`A`A`d% @,4 @d&O h /"OCh Ѓd @4 (B#`B#`B#``&O h  G\d(/"OCh(A`A`A`d( @,4d&O h//"OChSi? @4de  @4 8 9e @d,?&Oi hL(G \//"OChSiV?, @4de* @4F8(9e @dB,?&Oi h "O65! @4&O "O*5 @4&O "N^2 )//"OChSi @  02 02&Oi hp$LG ///"OwfUDn{$5 @4r @4 u } @4 5tE @4v @4 [ht @4fde @4im$ @4de @  II`Y`,95 @d_ @d_ @dRQB,0`$YW<9e @dV @dSCR<0$M5Tv @4R{ 6Qp&pX<8̼d(; @4: @48 @46$ @4`2&B&i&h#o n ////"OChSjB?ni;9$ @d 6 @4+ @de* @4 @d$d& F5!FЃd @4e @4dVU2&B&j&i&h#o n\dh xX$,< 4  4  =H ,////"OChSkcj?^ @d %SЖi4 @,9W @deV @4M @ddF5FdI @4 ir<9$dBгe @dk8?Уe @db,?&Okji h ///"OChn~8  ,,ЃiO,9 @d ")Гd @e* @4% @dg:dUVp~ @db3.0& @d˿d 2&B&i&h#o n"O @ &O /"OCh 8 @d&O h\d(((8 , ,K=XH,/"OChUſ8* @d ) @d &O h ///"OChSjcit @5 @4 @4( @4(A`A`A`(䃀Уe @4Гe @4`&Oji h /"Och @td @e&O h(H)( ) ,* ////"OChSk?R045 @: +#`N0 @4Lٺd  Һd -@ @de8( @4f>$5 @4e0 @43( @4/ 5 @4e8 @4 & @4 5' @d( @dd@1 @3/@2V@1` ,7,9vfrgdu'p @d*Rr79vfrgdup @d*8"9բf*d|8 * T   ` 8+l E ,K̋Y9fdWU @ MГd @*O @dJW @5eX% I @deL @d9 H0 @4w,?&Okji h //"OShD @(tiB(x @de5 @d &Oi h/"OCh6 @(t44 @% @4% @4H@H&O h//"OChSi#(u @(tQ Ќ45 @5 @4D&@3@2 R.TUN_I@H@IHHH&Oi h|()& +H    t G  xX`@///"OChSjciN @t J @40  x;Уe @deA @d&Oji h /"OSh3 @4 f g b1Ѓd1 @$$&O h /"OSh' @4 f g) %-bd @$$&O h/"OCh Ѓd) @4d& @,4Ѓd5 @<4d @4Ѓd @,40(C3`C3`C3``&O h<) H)+ |   p0)/"OChf(A`A`A`df @,4XЃd @<4d] @4VЃd @,4dS @<4d&O h4/"OBSdu?`4tC @ y%y4o> @ nf<4mA @ e],12!T8]U,4\6G- @ R45f, @ H@<4F5/ @ ?44- @ e7/,4% @ 0'>,$,4 @ %<4 @ ,?&O h b$̯ F///L=Slml $d ! Xl"!X!T)P!$!`H/"OBSdu?`4外Y @ ⧐%4埖T @ <4T @ ,12!8,46GD @ 45fB @ wp<4t5B @ nd4@ @ ef_,49 @ _W>[T,42 @ TM<4. @ J,?&O h b$̯ F///?L=Slml  ///"OChAj:db("i#b2L#T@3M@2dd Ea@Qd AEfSEdb#R B )!a$dh !l"!X!P!$!``a<1T@2t4. L# 4<'Ѓd @e#e @4! @4 Y04DCS6 CUu5O \ `# j "jBc4 @> )@9 BeAT^O @4 )@,4 8dhl0|)T8  E,KK nBe @dk @4 )@$ g @4 )H a @4f @d<8`5 @de d`b#Rd B$u`2&B&m&l&k&j&i&h#o n//////"OChSi}?nrrU=r @4L @d  G @ddD @ d@2 @  5 @df5Q. @4Š ; @dd8 @ +d3 @   j<<:# @dd"D @De# @4| @d0Q$ @di @4aAbB0,9ad  @{cC=-`\ߋ @4aA\{֯%x  X $F G ,K +,`$,V @4K% S @4fMІI @4I @43 O @ddL @ EdH @  nd5 E @ddB @ >d> @  Zd5 y9 @de/NF @4 (ЃkG,45 @<;+ @d# @d5 |* @d0 -*U% @4 @d ͠  @d *à  @d z @d zJ& hTH)  H1  ,K  `$,Y @d * X @dd@3b@2 @1&@3=@2Z PQ @4L @deL @4LW4{HJ @4vEвe @4qGI4J4H>tUU$FU$U$U$U$U$U$H8>ղf @4WH4`H4U$FU$U$U$U$U$U$+!ղfW @4<45$ @d e! @d& @5eX%&4 @ ,  @4 F $5 @4, $5 @4$ @4 @d$- ( (|)T&8         @ Z, @4jY @d:P, @4f J @dG @4|M, @40de6 ,8e @4f7d @5 ^5Гd @57 @4,6 @4iR,9S8# :I1Гd @5R0Гd @"*i>(Ѓd @9j" @d:1Гd @5 *Гde @6 @dJ0  @dd @ j @dRcg3Sdf CE 2&B&l&k&j&i&h#o nP<)^^X D, T) ,`$0),////"OChkg> @;5 @d|aQ AdXj,:aCqi*<9b("!- @d.Ed56 @,4e! @48"<85 @de @4 b") &Okji h/"OCh @ dpp 4 @ Ѓd @4d @,4d&O hh!) \+ ,^,,K////"OChkU @;N @d}aQ Adj,:aCqi*<9b("!E @dEyd56 @,4e; @4l:<85 @de9 @4 b") &Okji h/"OChRNH$c~3S CdIA8fbe@52&X%B&&O h//"OChi09dH$c3S Cd&A8eRb@2%br")&Oi h ////"OChn @ j!렣`h + ܋,,K]*!PЃdM @,4 adQ Ag7qvfbrg2du&u!Wdc3S C"f?Ѓiu,9 @d  > @d>id56 @4e2 @4d[25 @,4e2 @4 * @4du 5d{ ( @d(:d56 @,4e @dЃd, 5 @<4e @d [ @d :@,b("@DГd @dCeP2+P1 P3 P2"L@1%& hpxT + ܋,Q )UTR)Anz @d)H @4 5< @d< @d 9 @d c1S Cdk-d E  @3 @4adQ Au@- @4@* @4=2&B&m&l&k&j&i&h#o n\"OARctQ',1TQ4 (6WsdUrc3S C  &O c5 F///L=Slml hp(T 2$  ܁H`  /"OShC`cdfcb2#P H$gbc3S Ccd (z<6cdBa!(Bb"(&O h ////"OChSkc?3 @dadQ A찃d Ơ Qi9b!R Bd+ @ddCeP33P2P1NP3o !@2} "@1~ * e @4e @d  c;e @4e @d @4m  @d e @4e @dE h\5    * xВeV @4e} @dxfve @4XUV @4es @dXs @4' v @dcr8=e @4ej @d8j @4 b!R BdeaQ Ad_cd3S Cu db!R BW @d *d A  ,?&Okji h "OCfcb2#Tt64YbacdQ AE&O /"OSChdubk2#TS04 7 B @5Tbd#Rf BE&O h "OCfcbM2#Pkbb#R Bcd&O //"OChSi6%56 @4e @4d(5 @,4e @4 Гd @5d @ b[#Rfd BE @4$&Oi hhpT&\5 T    ܁,@/"OCh @t(5 @445 @4(A`A`A`@ダ3L"!"#&`&O h.`-+/"OCh(A`A`A`4 @4(v @4x @d&O h /"OCh{@3(t# @g4 @4wx @d&O h//"OChSia(u @(ti445 @4o5 @4@32`H1P2PL&Oi h /"OdChuX @(t4xG 5 @d&O h ///"OChSjciG @(te; @d4P @4a>(4 @)4xF @d&Oji h ///"OChSjy3( @40 2(e @4e' @d &Oji h/"OCh) @ ! @45 @4 *5 @4,5 @485 @4D5 @4(A`A`A`d`&O hT..dl-H)-<8--T-$.h"0-..,L,.L.`,/"OCh(A`A`A`D @48 @4, @4 @4 @4 @4 @d&O h//"OChci @tx @dp)&Oi h//"OChci @4ez @4} @4x @dp)&Oi h///"OChSjci| @t9 xgГe @der @d&Oji h ////"OShckDtCjyj @d0 VГe @ddS @e +QЃe @d_ @dp+&Okji h///"OShcjDtUCi @d: @Уe @deK @d&Oji h /"OCh< @t6 @47: @415 @44 @4-D @4.14 @ed6* @41 @4!, @48 @4HPQ$&O h////"OChSkcjy @40 e @4c3 ,xe @de @d&Okji hp<)|)).8     h". T).,/0)/"OCh1 @ dR#4dQ*5 @,4,ЃdJ @<4dC- @4(Ѓd; @,4d=) @<4'Ѓd4 @4" (B!#`B#`B#`Ⴠ!4Cp4Cp44Cp4Qp @d6eʾ<4  @4` &O h< `/8 Tx ,-+,@p(d#/"OCh[(\A`A`A`$Bp$Bp$Bp$dP @<4NЃd @4d|H @,4KЃdx @<4dw@ @4@Ѓdp @,4(dg4 5 @d&O h /////"OChSlck7 @d+45 @  'd @  j4:y @d0w $ @d d@2@1W@3<`  @d( Гe @4UBd @d(Гe @4d5 e<x-0l/,(,,@( a @dW(e @4壑d 56{4dUY @ U @dK(e @4TUDUSУe @d L @dD @deI @dJУe @dD< @d@ @deA @dCУe @d&Olkji h ////"OCiSjn0ГhP4 @85 @d1 @ddB"56 @,4e" @4'Гd2e @<4e @4 d @4 9T41 @: @de @4d @5b("-% @4Тe @4' Xd$&+0(,,#`!"i$ @4iЃd @5d( @4dЃd @5] @4^ @dVcf3Sd CEU @4(2&B&j&i&h#o n//"OCh|?nw@ @4 mjU;f @4c8 @4\A@F @5T5. @48/ @4.d @5e% @d )O) @dO a!)'% @ @dc1S Cd `Ѓd& @,4 d@1SC@3EH@2K@1Eȵd FN  @d ?G d 9A ht[Sp #, 8   H T ԟ,(,`!d  cj3S Cd U<8 @db#Rd BFu2&B&h#o n//"OChw?nr= @4 gdU8_ @4\5 @4VA;F @5N5+ @43- @4*d @5e" @d )O& @dO a!%%" @ @dc1S Cd Ѓd! @,4d@3 J@2Եd 4 ajQ Ad 8 @d-ht[Sp 8      Xcd3S CFu|2&B&h#o n///////"OYCjn?n:Уid9dh,8d @3d @d/Qd @2!/ @4b!R Bd  'УkG; @d dCe\ P3 P2r P1m P3h P2c @1 C@3A E@2%H@1) I@3< J@2? K@1 ~ Xh\S P!p($l @ddd @ ep @4aQ Adjk @d  a @deZ @4] @dea @4aQ AdQ @d bk<;PT56 @deD @4HXd @5eL @4 bZ#Rd BE] dv5 U ? @d>гd @5d1 @55\6d @5c/P5d @4e3 @4 # @4 <,d @5d @e" @4ݡ  @d ա Уk$;<56 @de0 @4Hгd @5e0 @4 2 @4Ncf3Sd CE p(&T  )   ܁Hx qУd @5  de(6 u 6d m td e d ] :d U Jd M ޳d E H @ddB @ eQ @4c1S CdHk @d j > @deF @4=Уea6d @<5 0 @d P  9 @d  D & @d  & @de) @4aQ Ad @d ՠ % @4 @,6d @5e @48Гd @5e  @4 3 @4 = @d삠k$&T/   z #`x LX @4Z=5 @dI @ddFW @4 E4d @5dDL @5O @d ;L(6d @5eA @4DFГd @5e9 @4 < @4 =>D @4$ ,Гd @5d, @e2 @4 =.L @40 @4f&!4 @2de责d j,! @d0e @dc3SdfW Cu @dS e6d @,5 G  jc3S Cd+ $#/#. ,--z H#`^ 85 @T dZ @4T @ddcd3S CFuQ @42&B&m&l&k&j&i&h#o n ////"OChSjnBЃin4 @95 @43 @db!R Bd3 @dߠ 0 @ddCeP2 P1 P3 P2 P1 E@3  @dd @ e" @4c1S Cd @de @4 @de @4 @de  @4 %b#Rd B8u h &    T!p((x RЃd56 @4eH @4HЃde @,4eI @4 [adQ AEa c1S CdD @d W : @dd5 @ e@ @43 @4, @4aQ Ad1 @de4 @4 cj3S Cd8(6d @5 #) @d c1S Cd 8 @4e @db!R Bd @d  @4 c3Sd C4u @4L2&B&j&i&h#o np &$  \x 2(x /"OCh_ @  adQ A4u&O h//"OChaQ A Wk @d RЃi9M @d 【 4LJ @d w4b#Rd BJu&Oi h/"OChaQ A =k @d X1 @4eS<8+ @d- @4cbd#R BE&O h//"OChn @4 @4aQ Ad!Ѓd @Dv >  @4 5 @4e d @6 @4  @4  @4-hld\|)P  8  z  0 bd#R BDuV @4T @42&B&h#o n///"OChnIЃi$d @9c1S CdPgc3S Cd bCЃde @$B @d@ @dm<865 @dd8 @e4 @d b#Rd Bu. @d2&B&i&h#o n/////"OChn"Ѓk>4 @; @4b!R Bdcгd @6SCJdEd!6U @4 cd3S Cu b!R Bd @dudb#R B h    K<_ @dd[ @  cWЃjd @,:yZ @d0;LГe @dMeH @4eO @dL @4K @deB @dJ @ddC @  ׉EЃdo5 @<4h98e @d; @d: @48 @4LVg,7rvfcrg,3dIuE1WdaQ A2f, @d& ) @d+Ѓd;5 @4% @de  @4e+,8 @d @4 @4 @4badQ AE @4 @4(2&B&k&j&i&h#o npl<)|)\  8 h   .`0)///"OCh&j<:aQ Adb!R BdJi @d r DЃi},9,4 @ec1S CdA @d _c1S CdPcd3S C2uQ LdF b!R Bd3 @d Cb!R Bd,d @2v 7'De @4b!R Bded )b!R BdЃd/ @<40 D @4'<8 dD @4,8d @5d @eaQd A2u&Oji hh#. `` ////"OCiShİ aQ Ad3Гd_ @,4 . @d(H() ` Dx. @dGafQd AE e?d  {! @d0гe @d jde @6de @6  @ded gT:b62! ,9 " @d Тe @d h/T$<4(,\33,`wA9# @dDГe @d: @d< @d@8% @d9 @de6 @d9Гe @d1' @d5Гe @d-! @d/ @de+ @d-Гe @d$ @d)4&Okji h//////"OCmSi @ ~ c1S Cd @4 k; @d : Tt4=@3 % hT 7(44(,3,l3|3.uj<:laQ Ad7гT @RS!)c1S Cd/& @d -c1S Cd) @d *вe @4%Уe @db!R Bd (4$$$$$$$$$ @df @45 @4Уe @dPxTL8  @d  C d @F Ѡ <&T/.l   j<:laQ Ad#c1S CdR @d  Ne @4Kвe @4HУe @d  Beu,5Tdp @4e8 @d!c1S Cd5гd& @ =aQ Ad. @d 1вe @4+Уe @dc1S Cd % @df!+ @T"Уe @dPxTL8 @d C d @F ?aQ Ad mc3S Cd3 Ʈ <=& @dЃe @de @d"<pP(T/.(, ,x .(&Omlkji ht4=@3  /////"OChSknY @dVn @d n jdaQ A<:ԿT WEi @T19AE @d %b!R BdBk @d G=Тe @4;e @48e @d 7d[25 @4e+ @db!R Bd/k @d !'Ѓdf @5 # @d) @d c1S Cd " @d 4 @d @dD2&B&k&j&i&h#o n ///"OChSji 9Pe(d  hp(&T )z p((&Oji h //"OChSil9 @4 c1S Cded c1S Cd e d &Oi h ///////"OCjSh=?n"Уi8H4"b)2c; @9H @4 @d 44DM# VJ J&FzJ J J J J J 49@3  ph\`T p( : @dl8 @ddb!R Bm3 @d 6 b!R BdHdeU6 ) ) @d ! k>db!R B; @de @dгe @de?d   @d c1S Cd @de @dгe @d e @ded  e @dU T(,,(//.s @dlq @dmoЃdh @!l @dc#aQ Adf @d  aQ AdHde6  H^ @4 U(4 5 @ QУk<;$ @dSгe @dO @d  c1S CdHe @dHde6D @d l akQpd A<;: @d9U @d;гe @d4 @d3U @d5гe @d0e @dHdel6 @ -H @4$45 @  $ @d#гe @d @de @dгe @d @d  b!R BdU @de>d   @d e @d гe @dUd\`(,,(//. c @d\laЃd @#Xm!b!R BdZ @d ʣ b!R BdSe @dHde6  N @d  bk!Rd B;C @dBe @dFгe @deϽd  : @d9e @d=гe @dedc1S CdH5 @4Hde6 v Ped+E,H @4#Уk;;# @d k3<;" @d @d гe @d @d @de @dгe @d @d : k ,;  @d2eX%pWd\`5(,,(//  .Z @d_гe @daQ AdY @d  aQ Adܢ L2c8#bq#R Bdc1S Cdk;E @dDгdA @"eGгe @dC @d Ԣ = @d7l;Ѓd @!3"c1S Cd5e @ded  D.Уd @F  b!R Bd* @d  b!R BdHde6  Уk,,; @de @dгe @d @d ~ b!R Bdd 2e @ U m ,= @d20du\`(,,(//D/.aQ Adn @d B aQ AdHdea6 5 fH @4d.u_ @d # bk!Rd B;@N @4T @dN R @dNdD!"M @<,B@d @5D @dCe @dGгe @de&d @9 @4 3 @daL!/ @dl- @dcLC) @dd+ @  cW4Sd CE' @d @daH# @d'гe @d @dbD. @d @dfЃe @dЃd @2e$ @dгe @d @ddBaQ A @d@ @4j \//؄@(,,/(/d/. _ @dlZЃd @ec1S CdT @dR @dO @d M @ddrc3S C > m,=K @d N 0> @40CГe @49 @dd:0 @5 aXQd AE 0 @dd30f @5c1S Cd0 @d 0( @4 c1S Cd0# @4٠ m:&Ѓd @,=l!Ѓd @e# @d adQ A0uޠ  @dcL>8# udb#R B ͠ @daLb!R Bd @d  /(t (/h/D/aQ Ad_ @d  aQ AdT @d SУde @<4aQ AdQ @d z aQ AdF @d FУk}<;e @d ku,;Dгe @dc1S Cd> @d Uc1S Cd3 Hde6 HH5 @4kQ<;-% @d*H @4e* @d &Уk?,;$ @d(гe @d$ @d b!R Bd @d b!R BdH4S2!R @"# H$ @4H @4 2&B&m&l&k&j&i&h#o n\`T&(,,( .//"OChci  Pob#R Bd &Oi h///////"OChSicjo?nkk84 @;6H @43 @d 0 @d - @d * @d )H4 @3& @4ef갃d Ѡ 0 @d  Ѓm(4e @,=e @d  d<46Bb02*b,eX%85Bb02*b,dH$taQ Ad th\/(Tp(( @dc1S Cdefmd  He @4PG$Гe @d3&Olkji h/////"OChSlckv  "?j<:"' @d b!R Bdefcd i*,9 @d!Гe @d3&Olkji h"O @ &O "O @ &O h/(T & (,,p((,."OTW @ &O "O &O /////"OChSicj>  1k<;B: @d &bA!R Bdef*d R$S02*b,dH$5!)l_<<2+ @d3e @dӯ &Olkji h /////"OChSicjL  1:k<;9 @d &b!R Bdef8d R$S02*b,dH$5!)l<< / @de @dӯ &Olkji hhTH(,(./////"OChSicj>  1k<;T& @d &bV!R Bdef*d R$S02*b,dH$5!)l< % @dc1S Cdef,d 0P & @d 'aQ Ad ) @dГe @da!<1P܉CЃd @F ϯ 2 @dГe @d&Olkji hh\//THL,(,.//////"OChSicjTQгl!m<=d! @) b!R Bd  ef+d  C @d0 w,8儠d;) @d b!R Bd m efd e 1 @d0 T,8ad*8 @d ,b!R Bd J ef徃d B @d0z @dg0<7vi]vjE1fdi!,8,.d# @d 0b!R Bd  ef`d   @d0 5 hlT&,,8dP @ QЃe @d J6 @d 3b!R Bd  ef{d ؠ @ @d0z> @dgq<7vj]viE1fdrgrca3S C e |d-7 @d 1aQ Ad  efAd  # @d60z! @df7g 7pvi]vjEdrgvb#R B e Ddefd t 6 @d  @d&0> c1S Cd _e $dhlT&(,,.O7 @d M @d&0 c1S Cd :deA . B @d '@ @d&0?| @dfgj 7vipvj]ErgvdaQ A eҽd #19*гe @d&Omlkji h ////"OChSkcji29гd @e cu3S Cd S3:cвe @d@e @daQ Ad  9 @d/ @d+ @dOH$lG<гde @6  PQPU7u @4 T6 @ti4z @dbg#Rdf B @4Q2&B&l&k&j&i&h#o n//"OChciA?STH$ @2 @1@3@2 $ @4dfe& @4 H @4dfeH @4,?&Oi h/"OCh6 8 @d&O h  (( ( P(,:܁,p(%(!/"OChQ @ dE @4KЃdy @,4dwH @<4;"!d:"#n&p 4; @ h:8 @d&O h////"OCiShck-4 @1 @d  .ГjB<:5 @d, @d,Уe @d$6d @5T@1M@3@2@1Y  @dUKd @dUX% @4r Qad:e @dTUD4UXp\`4(0 ,(,,$.4xd(T56 @4X @dUdV @ XУe @dQ @dTУe @dM @dLU @dNУe @de L{ja! i<9C @dBТe @dDГe @d4 @40&Okji h//"OCTevP?T/ @4FC. @4C,( @4=,4 @8y32x' @4 @4 @4T5 @4 T @5 @4T @4 ,?&Oi h (.$ ,-- (,,p(( ./"OCh|wdrdndidddtd[VdQdLdHdDd@dtdJ%<dDt;?d::d:yd0Ll|     8 P h   $4D P\,h@tXl 絽d簽d竽d禽d梽d枽d暽d畽d琽dd牽4ՅdՁd}dydudqdmdiddd_dZdUdPdKdFdAd4d罼%d9紼9d櫼vdd5礼e5dd睼e4d51甼61td捼u/爼d/d灼4ud+x6+dq4)yd  ,8<HL\`hpt$4 H(X0<HT`lx$dt廃dໃd4dػ5ӻdՃdͻtdՃdƻudՃd滻t綻d类dtd檻u祻d砻d朻dd斻t}瑻d4d56yՇ7y炻dyd|txwdvrdudkrfdqd`totdYelTdkOdiՃdItgՃdCttdՃdAb2de @0"P9Гe @dcCCpad<1eqB! Q1Гe @daSAAb22+Гe @d c8#&e @dbr",&Olkji h//////"OChSicjsl{ @d0гe @dcCCe<5d @um гe @daAcAb22.\!..h!P0{9dDDmL=lad1 4 ]Уd @5a3 ,2440, &Omlkji h///////"OYChnG ҠRh4V$V$V$V$V$FV$V$V$V$V$V$n: @46f @4 [2 @4edղ6-4 @9$ed6 + @4$4 @;,ed6 ! @4D6 @4Ded6  @4p4 @=4ed"6  @4]  @4 l< <4 h 0{, @d0!F* @ @j!Ѓde @,4d% @ i"гe @dfde7SQ3?د$ @4  @4ed46 @4 @4`h2&B&m&l&k&j&i&h#o n<) <h ..,///////"OYClcinW @ h/j:KqdDkD @;eE @4S5 @4C @4v2$d 5fg<4E5 @40Aгd @5e8$ @4 $7 @4d<4d @5e.$ @4 -$ @4p /,5 @4 ;<4 @kl @4e# @d -@4l| @4 @4 @ F @4E @d5 @d=гe @db 2> 4 @")e7 @dc 31d @2)/ @4e;dj)e @4,U @db 2&4 @")# @4` @d  @4 @4 @42&B&k&j&i&h#o n/"OCh @ (A`A`A``&O h $8 @<  ""O $A`AA`AB`C @ &O "B! R" "! "# "O &O "O &O "Oc`sfCgSde 7hG~ A &O cf$g!i2km$Q5UY'Y 8ifUdU "//"OCh?Svce @4YE @4Kxe @4J @4q,?&Oi h "O7; @ &O "O36 @ &O "O34 @ &O "O޿ &O ///"OChcj$ٓd9 @5 @d+ @dd @5 X-Гd @5 8zd @e 4&Oji h /"OCh @4"&O ht[D  Hx<T|WpU\U  T! ̑xGz@//"OChVY @4SxFԆe @,4&Oi h/"OChG?w @4"&O h//"OChB7 @4Bx2^e @,4&Oi h"O5v+ @ce&O "O0& @ &O ! ///"OChSi4?n @4e @4 5 @4 5 @4 @4e @d  @4 @4 @42&B&i&h#o ndף@@ |W8 U \U!sl! `8!/////"OChSkcjnٙ @d @d @de @4e} @d )O @4O b(".xe @4e @d )Os @4O c8#lгe @deh @d )Og @dO a!2&B&k&j&i&h#o n"OeXԧ @4&O "OZRԛ @4&O /"OChM @4UHԈ5 @4W @4eW @dE @4&O h /"OCh= @4J8h5 @4G @4eG @d5 @4&O h "OCe. @43) @5+ @4&O "O-" @ &O ' B! //"OCTev+ @d& @d#95(6 @de @45  @,4e @4 &Oi h$t[  8  \ !sl!T!̑#8!`xBUX%Sd C` CUX%Sd C` BeSVh&b$BeRUX% R$QVcQ5ceb$aVSQ`1b$ BePaa!QS1SP3SR"$BfbVh&ceSVh& R$QVbR 5b$ceaVb$ BaRb 1 ) CVbQbWx'AAS1Ra4 AWrQ4|5b%cB aBVcQcWx'AAS1Ra4 AW sQ4|5b%bC a//"OChSi(f`8XUSd@c/"OSh @5e @dd`&O h>////"OChSjn5f @5e* @4-d @5e, @4 %d @5i  @4fУe @d "5 @4 @4fe @4g Vd @5c4 @1  @4  @4p,2&B&j&i&h#o nC6 2> * \l>>"O @ &O >//"OSh @5a(`&Oi h{/"OCh @  @d&O h?>/"OCh6 @5`&O h?/"OSh @5e @dd`&O h? AP////"OChSj[?n5Уf @5e, @4-Ѓd @5e* @4 %Ѓd @5i" @4fТe @d "5 @4 @4fde @4gV d @5a4 @d @4 @4p2&B&j&i&h#o nD0?= ?\+(DD2?p"O @ &O ?//"OSh @5a(`&Oi hT/"OCh @  @d&O h(@?"OBeATX4 @&O B`W <0$ C`/"OChЁU @d @d&O hT@AP p //"OChSiTQ4 @eSs1 @deГf @d&Oi h "OAQq @d&O "OBe @AV&O @$ C`/"OChЁU @d @d&O h`AAP p /"OChSfTQ4 @ceSs1Ѓd @U&O hLAQq "OBe @AV&O ABeAPX0!@ !@B`E \0$ C`/"OChЁU @d @d&O hA/"OChSfTQ4 @ceSs1Ѓd @U&O h`$"OBe @AV&O A"OBeATX4 @P&O $ C`/"OChЁU @d @d&O h @ddh`Cef @de8 @dd\`485 @44 @4/ @Tk2e @4f,e @4 4+e @4k# @Tf#e @4 # @Tc8#!ЃdW @5e @dd`V cgd @5e @dd `Ѓdf @5e @dd`2&B&k&j&i&h#o n2HId xD/////"OChSlck3 @ji)3 @de-f @4 ,Гd @jd* @ddBi e @4e @4d @5e @4 JdH$  @Tfe @4 JdH$Ѓd @5e5 @dd` &Olkji hF\032DGx/////"OChSlck @ji) @def @4 Гd @jd @ddBi e @4e @dd`&Olkji hF2DGx//////"OChSlcmUQ5Sd0 @uS/ s4e @1Vl5-d @v*d @5& @49 ! @d dD#Cie @dk$ed @fje @d zUd @fj @dl @de @deVX6d @F(-I;0&Omlkji h\57 F Gč/////"OChSj:q = @di< @d9 =Гkd @=Kl= @dg5Гef @dUi6 @d3ЃdeVX6 @F(9D( @d0* @dk+ @dj% @df(Уe @dd$ @U&  @dl @dk @def=Kd @5 @dk @dl @dVKe м< @d-Ikc31`&Olkji h  Gč 0/////"OChSlck @ jQ!УfU @dk\,e @diQ!ГfU @d믓k`&Olkji hX///"OChSj* @de @d @dei @dj&Oji h @uSDs14eVgIVfr$aVfVgbstRe5DR$VceBvd @(55dVfHVgb$qVgVfrctRe=R$( @d dDCiГe @ddj!e @fke @dD{dU @fk @dl @de @dЂlTD @4f e @d(D,:T&Omlkji h  It\/"OCha! VЃdU @vЂeV @d&O h/////"OChSl+I @e' @d ;&245 @%eЃd @Qj(Qи1AA:Ki9fd @ee @4ye @4R @"e @d S,36&Olkji hO ̘$ R//"OCh/?4@IVfIVgb$qVgVfrctVfReb$Q @d @dR 5 @TUu @4S6,?&Oi hO0`/"OCh @UUu @4ЈT(4 @F&O hOl//////"OChSlcmUQ5Sd1 @uS1s4e @1Vl5+d @v-d @5$ @49 , @d dD"Cie @dk#ed @fje @dzUd @fj @dl @de @deVX6d @F(II;&Omlkji h 88  Q  \Kd0)/////"OChSj:q F @di; @d9 =ГkKd @Kl< @dg5Гef @dUi0 @d3ЃdeVX6 @DG\/////"OChSlck @ji) @def @4 Гd @jd @ddBi e @4e @dd`&Olkji hF6DG///"OChSj* @de @d @dei @dj&Oji h}/////"OhChSisjneTRQ41k @d mУe @4ka @Tf`вe @4 V$`cgd @5eY @dd`[Ѓdf @5eR @dd`P42O @ddQ @ kRe @4fFвe @4 E @dgFФ(d @5e> @ddh`Aef @de8 @dd\`485 @43 @4. @Tk6e @4f*вe @4 4/e @4k" @Tf!вe @4 #& @Tc8#ЃdW @5e @dd`V cgd @5e @dd `Ѓdf @5e @dd`2&B&k&j&i&h#o n=HI  d//"OChSfn @5e @4.5 @45 @4Uf @d 5 @4 5 @4ЃdV @U`2&B&h#o nD/////"OChSlck2 @ji)3 @de*вf @4 +Гd @jd) @ddBi e @4e @4d @5e @4 JdH$  @Tfвe @4 JdH$Ѓd @5e5 @dd` &Olkji hF=?DG\/////"OChSlck @ji) @deвf @4 Гd @jd @ddBi e @4e @dd`&Olkji hF=DGBaRb 1:c <` //////"OChSlcmUQ5Sd= @uS4s4e @1Vl55d @v)d @5, @4= + @d dD!Cie @djed @fk$e @d{Ud @fk @dl @de @dlT @4fe @d(,:(&Omlkji h8  L(8-T /////"OChSj:v D @diD @d9#<d @ l; @dg?Гef @dUi7 @d9ЂjT @4f/Уe @d(9F- @d0( @dk( @dj# @df Уe @dd# @U(  @dk @dl @dfed @<5 @dk @dl @dVe,< @d a1`&Olkji hX  L 8-T<Ț//////"OChSicmUQ5Sd+ @uV%vajl5d @v8)( @d dD Cle @dkГed @fje @dzUd @fj @di @de @dЃdeVX6!F @!F(L;&Omlkji hп  . 5bdfg @e+ f @4e* @d@`. @4d$ @Tm,e @4f%e @4 d#`&5cdfg @e(6 @4e @d`$ 56 @4e @d`02&B&m&l&k&j&i&h#o nF`\2DGdx"O7b'4 @gdC`&O "O @ dC`&O "O7b'4 @gdC`&O /////"OChSi\asj:cdH$De @4k= @def9bf @4 %d8e @dk= @dd$b : 6 @dd6в$ @d d2 @ddBb :. @dd$ &e @dk @dd'в$ @ddBb :# @dd$ @dd Т$ @dd$ @dd"$eu @dSs4e @1e @dd`&Olkji h=HhFdDGLGHI///////"OChSicjn^ @kdBl,Yke @4mN @defIbf @4 mR @ddB @ddBdޯClFe @4eE @4-(Ad @5e: @4 d3 .5bdfg @e0 f @4e/ @dA`3 @4d+ @Tm-e @4efbf @4 d#`5cdfg @e(6 @4e @d`$56 @4e @d`02&B&m&l&k&j&i&h#o n=\H\PF5dDGX/////"OChSi\asj:cdH$Ee @4kA @df8e @4 %d>e @dk5 @dd$b : . @dd.в$ @d d* @ddBb :' @dd$ +e @dk$ @dd в$ @ddBb : @dd$ @ddТ$ @dd$ @dd"$eu @dSs4e @1e @dd`&Olkji h6DGLGHIЕdF///////"OChSicjnT @kdBl,Yke @4mT @dfJe @4 mI @ddG @ddBd߯ClKгe @4e< @4-(7Ѓd @5e@ @4 d:. 5bdfg @e2 f @4e0 @d@`) @4d0 @Tm-e @4f e @4 d#`"5cdfg @e(6 @4e @d`$56 @4e @d`02&B&m&l&k&j&i&h#o n 76DG LЕ\dؕF"O7b'4 @gdC`&O 0"O @ dC`&O 0"O7b'4 @gdC`&O t`H5bbd @5e9 @4 d> .5bdfg @e- f @4e+ @dA`0 @4d' @Tm*e @4efbf @4 d#`&5cdfg @e(6 @4e @d`$ 56 @4e @d`02&B&m&l&k&j&i&h#o n=@D\F9dDG /////"OChSi\asj:cdH$Fe @4kA @def;bf @4 %d. 5bdfg @e3 f @4e3 @d@`. @4d$ @Tm!e @4f$e @4 d#`&5cdfg @e(6 @4e @d`$56 @4e @d`02&B&m&l&k&j&i&h#o ndėF\2DG`̗l"O7b'4 @gdC`&O "O @ dC`&O l///"OChcjSiy: @ddB)&Oji h`///"OChcjSiy:Вe @d &Oji h//////"OXChclzUSiTH9]!IZ!Iy=aA:,V:lJJ<Fl<4*Imuf @= I&m=u @f- %45 @4dBb,:zke @d,jTbU2BBl,<DLe @4kD @dfAe @4 %d3e @dk7 @dd$b : 0 @dd0в$ @d d, @ddBb :) @dd$ e @dk& @dd"в$ @ddBb : @dd$ @ddТ$ @dd$ @dd"$eu @dSs 4e @1e @dd`&Olkji hFdDGLGHI2///////"OChSicjnV @kdBl,Qke @4mV @dfRe @4 mK @ddI @ddBd߯Cl>гe @4e> @4-(9Ѓd @5e> @4 d<. 5bdfg @e8 f @4e6 @d@`+ @4d# @Tm%e @4f(e @4 d#`$5cdfg @e!(6 @4e @d`$56 @4e @d`02&B&m&l&k&j&i&h#o nFdDG\2(//////"OChSisjg?5ГdD @4e5S*.Гef @dK Edzu!E*DWe6 @5gP2L#f&devmKvl&vlvmvrgr&Lw6Kvmvl&vmvlvvkLvl&rgr!W @"fk Гeg @di,?&Omlkji h///"OChSjdD @4d4 Ѓi<9d @e Уe @d Уe @d&Oji h@L///"OChSjYXyT@9Уe @d d&Oji h|.//////"OChSlcmUQ5Sd= @uS1Xs4e @1V.XAcevd @5(d @5+ @4= - @d dD"Cie @dj$ed @fk#e @dX{Ud @fk @dl @de @dXlT @4fe @dX(<:h&Omlkji h.4Ed-4QȜp"O7b'4 @gdC`&O "O @ dC`&O ////"OChSksje5!E!E5/*>==*=+=-=//=%=++--~^|<<>>??????#include#define#undef#ifdef#ifndef#else#endif#resource#library#export#plibexport#cerror#pragma\]]ecd0 #$#@L,,]^ #$#4H,KS$eocd,KS #$#X4d #$#pe4xcdde4xcd )ecdP #$#@  )c dtdldBepeee€ԀLG,F=?!$"9MIABMTL)E<:8FBID)dNZIWKa#COREDLL.dllLG,F=?!$"9MIABMTL)E<:8FBID)dNZIWKa#`>>dp| $08@LT\dlt|$0<HP\dlt $<HTdCIntCCharCFloatCStringToIntToCharToFloatToStringLoadSaveArrayIncADecAIncBDecBAddSubMultDivModNegNotAndOrEqNEqLTLTEGTGTEJmpJmpZJmpNZRetSetRetSetRet0PopPopNLinkUnLinkHaltSwapBAndBOrBNotSLSRXorWordPFPRelativeCallRelativeStackCallDirectCallDirectStackCallDupTopDupTopBlockLibraryCallLoadNSaveNEqBlockStackToGlobalStackInitStaticLibCallInvalidInvalid^|, ---%d (%xh)%c (%dd)(%dd)%f%sNonevtStackIndexvtAddrvtIntvtCharvtFloatvtStringvtVoidvtNone%dThis program requires %s dynamic link library (DLL) The library found is not a PocketC compatible DLL library.This program requires %s dynamic link library (DLL) Please place this dll in the same directory.LibraryCallLibraryInitIncompatible LibraryMissing component%s|%d|"%s"'%s'%d%f"%d-%d-%d""%d:%d:%d"__LINE__%d__FILE__"%s"__DATE____TIME__""''%d%f\http:__VERSION__"3.0.0"__PKTC__1__PKTC_CE__1__FILE__Unknown__LINE__1__DATE__0__TIME__0DEFAULTDEFAULT\default.datErrormissing default library information\cerror.datErrormissing default error definition informationR3MENUOFFPKPCFULLSCREEN.dat\default.datarg%darg%dDEFAULTputsputslalertcleargetstitleMessageBoxconfirmabouteventkeymousexmouseypenxpenymenuguiidwaitpgetcsettimertimeridkilltimerposteventshowconsoleshowgraphicgraph_ongraph_offkeepscreen_onkeepscreen_offscreenxscreenydelguicbxsetcbxgetshowaboutcleargsetbkcolorsetLcolorsetLanglesetLdefaultsetfontattrsetpenattrsetbrushattrsetpixelsetpixelattrgetpixelRgetpixelGgetpixelBLlinerectcircleellipseroundrectdrawbitmapCopyFileMoveFileCreateDirectoryRemoveDirectoryGetFileAttrDeleteFileOpenFileDlgSaveFileDlgGetFileSizemenu_onmenu_offquitsleepbeepwaveticksgetyeargetmonthgetdaygethourgetmingetsecrandrandomcossintanacosasinatancoshsinhtanhexploglog10sqrtpowstrlenstruprstrlwrstrleftstrrightstrmidstrrvrsstrspnstrncmpseropenserclosesersendserrecvserdatastrgetcstrsetcregwstrregwintregrstrregrintdrawbitbltexeceditgeteditsetseropenexstrchrstrrchrdelallguifloorceilfileopenfileclosefilereadfilewritefilegetlenfilesetlenfileflushfileposfileseekfileseekendguisetfocusguigetfocusfilemodesetfilemodegetrunapptimerecentdocshortcutdebugoutcursorwaitlbaddstrlbgetcntlbdelstrlbinsstrlbrstcntlbgetcurlbsetcurlbgettxtlbfndstrisalphaisalphanumabsisupperislowersendmsgflusheventgetcurpathregdelkeyregdelvalLwLhcreatectrlformathexcbaddstrcbgetcntcbdelstrcbinsstrcbrstcntcbgetcurcbsetcurcbgettxtcbfndstrcbselstrcreatemenumenuappmenuinsmenudelmenupopwndshowwndmovemallocfreesettypetypeofkeyeventsetbkmodegetbkmodedbcreatedbopendbclosedbdeletedbseekdbrecnowdbrecwritedbrecreaddbrecdelpropdbrecdelmenupopexdbenumdbnamedbsizedbnrecsdbrecproptypedbrecpropcntdbrecpropvalmemcpyshowhelploadresrawiropencommwaitcommsetmaskcommgetmaskcommesccommclrbrkcommsetbrkcommclrerrwritebytewritebyteswritecharwritecharswriteintreadbytereadcharreadintmenupopex_hackdemo227fileenumfilecopyfilemovegetnotifygetsysinfosetsysinfopolygonpolylinedrawimagefileopen_hackdemo237seropenex_hackdemo238out of memory  <d!&d&w" p ,   $H < *8 + =4 % 0 3H O    `4@p28l !, D"!@!!0(!l!!!8!|  ;4 HX   , @` h. <,+ 0L.*d8,,h :;;$@.P<t 4X p (  (  h     ! $! 8! X! l! !! ! Ul""(#!l#)#!$!H$!$ G %@%<%%'H&& &P''B(H(p(((() )<)&)1),D* A*|+ ,,,,,-F-+.5|.../ (/\///-0 x1 G1 C2 D2 D,3<3L3\3l3|33 3D(4 <4 X4(4.5 $5\55P$6<707.7L8v|9d;,;;< ,<`<}\===> $>L> `>> >> > ?vEjF'G'lG XIhJa,K9KI4LM.M|O STS%SST8T"|T%TU.\UU= V |W4W2HXX(XY,\YY Y Y,0Z t[ xd\ M]B] ]4^,^5^"^ `` aZa)(bXbbN$c.cvtd8dve e g 4i oLo<,pLp q#Lq \s)s s tuw0w 4xTx4xx zD#0P' p!d؄4@',#t$n.X.4B T`xPI  x̑Ux RH4,pL *ԟ4Т  D7)Գ,, : : (*|   I8 X I|kT Z \ O`   ̾% (  PDT t ,,L H{ $8< ,d  |`LD' XD n  (RKdn@^ j CX :  y ~6P #d x   3P < T p d8 f  4t d#hp :$ P $     "H &    4 h  "   $T $ $ $H  `     0 H ` x ,"p.,, D \  Rh>@d< 0d L   0 H| LX$X p :d(P* ` z(6$ @\ ~ <`| ~  !8!\!h!t!!!!$!" ,"P" l(# @#d##### ~$ $ %D%`%%%% l&&&& l''(,(d((( ( (,0)<)H)T)|)$) )*,* z + 8+`+++++ ~, ,-8-T-`-l---$-. .$.L.T... .....,/ D/`/l///$/0 0 l01 ,1 D1P1x11 1 12 2D2 \2l2 .220383p3 33$3444D4 .444f5556 ,6<6 .66 6 77 7X7 p7$7778 .p8889 (989 .9999:<: T:d: .::;$;\; t;;; . <4<h<< <<= X==$=>> .l>>>>? ?0? .????(@ @@(@*@A$`AA$AA*vv x Dy <y( z { z| J}(} LT zH J܁  L r0 ` rD d(  J4Ddt,̋܋&h rL.č@\ (8T $0`|<hH.Ē*8.Г<HxHPXtЕؕ Dp̖ (X`hė̗0`̘ Xę <\6Ț(8H64\Ȝ$0@hȝ(8 xĞ  D0\ L 4` ĩ    Գt( 8d   ^D . 6 8Xп 8t( p ~ .h   P*$@\ 04 t  $<Xt$   $ < T p    0 D X l    $X*0`lx(4dp 0@P`p" 0"t  2Dp" 0 L"  &X$<\ & L d8`: P,T$`   ,Ll0l \(p; H &(F, 0 @ t8p b8.DP p jD,( BNHhD$P";\(\`\\84tphj]v]]\\\\]]!]0]>]L]\]  cepkpc300.dllPccBuildAppletPccCheckDefaultAPIPccGetErrorFilePccGetErrorIDPccGetErrorLinePccGetErrorMsgPccGetFuncListPccGetVersionPccIncludeAddPccIncludeResetPccMessageWndLibraryCallLibraryFreeLibraryInit66666666094989<9@9D9H9L9P9T9X9\9`9d9h9l9:::::::::::(;,;0;4;<<<<<<<<x>|>>>>>>>>???@0000000000000000000000222222222222222222222p4t4x4|444444444444444444p6t6x6|666666666666666666668 8$8(8,8084888<8@8X:\:`:d:X=\=`=d=h=l=p=t=x=|====P$0(0,00040h4l4p4t4x4@5D5H5L5P5T5X566666$8(8,8084888<8@8D888888H9L9P9T9X9:: :$:(:,:< <$<(<,<0<4<8<<<@>>>>>>>>`0 00000 0$0(0,0004080<0@0D0H01111111111111111222333 33333 3334444444444444444l6p6t6x6|6666688888888H:L:P:T:X:\:`:d:h:l:p:t:x:|::::::;;;;;;;;;;;;;;<>>>>>>>>>??? ????p 000 00000 0$0(0|111111112222222244444444444445555555H7L7P7T7X7\7`7d7h7l7p7t7x7|777777777788888889999999999::: :::;;; ;$;(;,;0;4;8;<;@;D;H;L;===============>>>>>>>>>>??? ???00 11111 1$1(1,1014181<1@1D1H1L1|22222224444444444444444054585<54787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7777777::: :$:(:,:0:4:8:<:@:D:H:L:P:T:X:\:$;(;,;0;4;8;<;@;D;H;L;<<<<<<<<<<<<<@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>??????<000 00000 0$0(0,000t1x1|111111111111122222h4l4p4t4x4|4444444444444H6L6P6T6X6\6`6d6h6l6p6t6x6|6666667777777777777888 888t9x9|99999999999:::::::::;;; ;;;;<<<<<<<<<<<<<> >$>(>,>0>4>8><>??????????????111 1$1(1,10122 2$2(2,2024282<283<3@3D3H3L3P3T3X3\3`3T4X4\4`4d4h4l4p455555555555555t7x7|77777777778888889999999`;d;h;l;p;t;x;|;;;<=== ===== =$=>>>>>>>>>>D0H0L0P0T0X0\0`0d0h0l0p0t0x0|011111111122t3x3|3333333344444D7H7L7P7T7X7\7`7d7h7l7p7t7x7888888X:\:`:d:h:l:p:t:x:;;;;;;<<<<==x>|>>>>>??000 00000 0$0111122222$4(4,4044484<4@4h5l5p5t5x5|55555555T6X6\6`6d6h6l6p6t6x67777777777777777888 8999 99999 9$9(9,909@:D:H:L:P:T:8<<<@>>>>> @0D0H0L0P0T0X0\0`04181<1@1D1H1222222222224484<4@4D4H4L4P466777 77777 7$7(7,7074787<7888888889999999::: ::::: :$:(:,:;;;;;;;;;;;;;;;;;;<<<(=,=0=4=8=<=@=D=H=L=P=T=X=\=>>>>>>>>>>>>>>>>11111111111111111111111111111222 22222 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x25 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|55555555555555555555555555555555566688888888888888888999 99999 9$9(9,9094989<9@9D9H9L9P9T9X9\9`9d9h9l9p9t9x9|9999999999P> >$>(>,>0>4>8><>@>??????????P1T1X1\1`1d12 22222 2$2333333333333333333666 66666 6$6(6,6064686<67777777777777777d9h9l9p9t9x9|99999999999;;;;;;;;;;;;;;;;;;;;;;>>> >$>(>,>0>4>8><>@>D>H>L>x>|>@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|00000000000000111222 22222 2$2(2,20242d4h4l4p4t4x4|4444444444444444466888889 9L9999999:@:D::::::,;0;`;d;|;;;;;; >D>\>t>>>??l?????@000 0@0X00000H1L1P1T1X1\1`1d1111X2\2`22222(3,3\3`33333334D4H4x4|4444455,5D5t5x5555566D6H66666 7P7T7l777777X8\8`8888888$9L9999999(:,:<:L:\::::x;|;;;;;;;;;;;;;;|<<<<<<<<<<==<=X=====>>>>>>>>>>>>>>??8?\?x????? P000000000000010141X111111(2L233 33333 3$3<3\3`33333344444444444445<5@5\5555h6l6p6t6x6|6666666677777777777$8(8\8`88888$9(9,9t9x999999$:(:::::;;; ;;;;;4;\;|;;;;;<<<<<<<<<<<<<=0=4=P=======>D>H>>>>>>$?(?@?\??????00000000000 11(1@1p1t11111222@2X2222(3,3l33334044444455555555556(6666677T7l7777 88h8l8888 9$9999998:P::::;;X;p;;;<<0<`h>>>>???????@$0<000000011X1\1|1111024282h2l22233,3\3`33333$4H4l44$5(5,50555555H6L6P6T666667077778h8l8p8t8x8|8888,9D99999:L:P::::D;H;L;P;T;X;x;;;<<8>> >$>h>???? ?$?(?,?0?4?L?d?|???P000000000001101P112222233444444444445555555555`6d6h6l6p6t6x6\7`7d7h7l7p7t7x7|777788888888884989|99994:8:<:@:D:H:L:<<<< <$<(<,<0<4<8<= ===== =$=(=,========4>8>|>>>>4?8?8><>X>>>??0?4?P?|??????0 0X0\0x0000 1d11112@2D22222222034333384<4@4D4p4t44445@5D5p55555<6@6l666666$7P7T777778,8\888888 9P9T99999: :8:X:::::::::$;;;;;;;;; <0$>t>>????????,1111 1$1(1,1014181<1@1222222222222222 3,3X3t4x4|444444444446666 6$6(6,6064686<6@6D6H6`7d7h7l7p7t7x7|77777788999 99999 9$9(9,909\9|99::::::::::;;;p(>,>0>4>8><>@>>>>>??4?T????0040l0p00001$1<2@2D2H2L2P2T2X2\2`2d2h2l233333333333444 444555\5`5d55666666666666667777788 8<8X88888909p9994:8:::::; ;8;P;h;;;;;<<= =P=T=======,>X>\>>>>>??\?`?????0,1p112@2l222(3,3333333344P4T44445X5555p77 99H9`9999::;L;;DH>h>>>>,?h??0X00000$1\2`2d2h2l244 4444$555555 666,666667848l8899;;0;4;;@>>>>>? ??$?0?>>> >(>0>8>@>H>P>X>`>h>p>x>>>>>>>>>>>>>>>>>???? ?(?0?8?@?H?P?X?`?h?p?x?????????????????@0000 0(00080@0H0P0X0`0h0p0x000000000000000001111 1(10181@1H1P1X1`1h1p1x111111111111111112222 2(20282@2H2P2X2`2h2p2x222222222222222223333 3(30383@3H3P3X3`3h3p3x333333333333333334444 4(40484@4H4P4X4`4h4p4x444444444444444445555 5(50585@5H5P5X5`5h5p5x555555555555555556666 6(60686@6H6P6X6`6h6p6x666666666666666667777 7(70787@7H7P7X7`7h7p7x777777777777777778888 8(80888@8H8P8X8`8h8p8x888888888888888889999 9(90989@9H9P9X9`9h9p9x99999999999999999:::: :(:0:8:@:H:P:X:`:h:p:x:::::::::::::::::;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;<<<< <(<0<8<@>>> >(>0>8>@>H>P>X>`>h>p>x>>>>>>>>>>>>>>>>>???? ?(?0?8?@?H?P?X?`?h?p?x?????????????????P0000 0(00080@0H0P0X0`0h0p0x000000000000000001111 1(10181@1H1P1X1`1h1p1x111111111111111112222 2(20282@2H2P2X2`2h2p2x222222222222222223333 3(30383@3H3P3X3`3h3p3x333333333333333334444 4(40484@4H4P4X4`4h4p4x444444444444444445555 5(50585@5H5P5X5`5h5p5x555555555555555556666 6(60686@6H6P6X6`6h6p6x666666666666666667777 7(70787@7H7P7X7`7h7p7x777777777777777778888 8(80888@8H8P8X8`8h8p8x888888888888888889999 9(90989@9H9P9X9`9h9p9x99999999999999999:::: :(:0:8:@:H:P:X:`:h:p:x:::::::::::::::::u@ PocketC CE API

PocketC Help 

Written by Jeremy Dewey and Kevin Cao

User Manual

PocketC Language

Database Programming

Function Library

check out BFsoft's Absolute Beginner Corner and Sundialsoft's Programming Tutorials in the OrbWorks links page.

User Manual
Concept
Step 1. Write Program
Step 2. Compile and Build
Step 3. Run Program
Step 4. Distribute Program
Features
PocketC Language
Introduction
Data Type and Variables
Assignment, Operators and Dec/Increments 
Automatic Conversion and Casting
Declare Functions
Statements
Include
Special Characters
Pointer and Walk around for Multidimensional Arrays
Resource
COM support

Windows CE Database
Introduction
Create a simple database
Enumerate databases
Read database contents
Write data to a database
Conclusion
Appendix - database functions

Concept

PocketC 's design is a mixture of a few modern language concepts.   The language is C.  Due to its invisible data type conversion feature, PocketC is also like a scripting language.  String variables can be converted to a float or integers and back without any special function calls.  It is similar to VB Script and Java Script.  

Due to Windows CE operating system can be used with various CPUs, regular software that are compiled directly to the CPU instruction can only be used with that CPU devices.  With our compiler, the source code is compiled into CPU-independent instructions.  This allow user's application to be CPU-independent.  We provide a free runtime module for PocketC developers.  This runtime module is required for PocketC applications to run on various platforms without recompile. Its concept is similar to Java applets which are CPU/OS-independent.

PocketC is not another ANSI standard C compiler.  If you are looking for an ANSI standard C compiler, we suggest you to take a look at gcc port for Windows CE.  

We provide our custom function API which are designed to make programming easier and fun.  If you have any good suggestions on new features, please post on the webboard or contact us through email.

Thank you.  

Kevin Cao

Step 1. Write Program

Writing PocketC program is simple if you already know C.  If you are new to programming, I suggest you pick up a beginner guide to C or read our language chapters.  Our webboard is a good place to share your ideas or ask questions at.  We have a descent size user community which mostly are software engineers, IT professionals, professors and students.  Hopefully, you will join us in the future.   Here are couple helpful links: 

BFsoft's Absolutely Beginner's Corner 
http://pages.prodigy.net/gwen.and.wolfgang/abc.html

SundialSoft's Resource Library
http://www.sundialsoft.co.uk/

Once you install PocketC, you should be able to launch the program by Click on StartMenu->Programs->PocketC Development.

Now you are ready to write some code in the editor.

Example: 

main()
{
    string hello;
    hello = "hello!";
    putsl(hello);	 
putsl(hello);
    alert("You say hi!");	 
alert("I say bye!");
    text(50,50,"hello world");
    graph_off();
}

In this example, we just demonstrated three methods of displaying text.  Please click on the function names to find out what they do.

 


Step 2. Compile and Build

Now we have a program in the editor, the next step is to compile and build an application.  Just click Build Menu -> Build.

If build process was successful, a message box will popup indicating the build was successful.  Otherwise, an error message box will popup.  After close the error message box, the editor will automatically jump to the error line.  

Step 3. Run Program

 After we successfully build a program, running the program is trivial.  Just click Build Menu->Run.

Your program will be launched.  Just sit back, and observe your first PocketC program in action.

You may also change the source code, and play around with with different functions in our function library. 

Step 4. Distribute Program

PocketC applications requires the runtime module.  We have an installer on the web for download.  You can distribute the runtime module with your program freely.  You may not charge money for our runtime module.  Thanks.  

End-users can launch PocketC runtime, and they will be able to see your program and launch it.  

Features

Function Browser

When you have a relative large program, it will become more difficult to move around in your source code. We added a feature to ease the pain. Just click on File menu->Function List. It will show you the file format, size and the list of function it contains. Just click on one of the function name in the list. The editor will take you to that particular function.

Multi-File Build

Some existing PocketC applications has over 2000 lines of code, and spread through 20 and more files.  You can use Multi-File feature to help out.  Just click Build Menu->Multifile Mode.  It will ask you for a full path to the source file which contains the main() function.  Now, you can edit any files and the compile will always compile the main file first.  

Font Adjustment

You can also adjust the editor's font type and size as well in Help menu.  Just click on Help menu->Preference.  A dialog will popup with settings for font type, size, tab length.  We even added a custom adjustable help system.  In theory, you link another help file with the Documentation menu.  In reality, WinCE help file must be in Windows directory.  That is the limitation of WinCE help file.  We cannot do much about it.

As you are writing code, the current line number is indicated on the status bar as well.

Command Line Support

syntax: <path>\pceditor.exe <file> [-multisession] [-directrun|-directbuild]

[-multisession] PCeditor will run single instance by default.  That means if PCeditor is running already, and you want to run it again in another process, the new instance will realize that one is running already, and it will terminate itself, and set the focus to the previous running instance.  This flag will allow multiple sessions of PCeditor running.

[-directbuild]  will ask the compiler to build this file

[-directrun] will ask the compiler to build this file, and then run this file.

Example:

exec("open", "\\PocketC\\pceditor.exe", "\\My Documents\\program.pc [-multisession] [-directrun]" ) ;

 

We update our software frequently to remove bugs and add new features.  You can check the PocketC build time stamp by click on Help menu->About PocketC.  The very first line will indicate the build time of your PocketC.  When you are posting bugs, please remember to post your PocketC's build time as well.  Sometime, the bug maybe already resolved.  You just need to download a new version.

 

Language Introduction


PocketC is designed and implemented by Jeremy Dewey. It was a his personal project during the summer of 1997. We met when we were both hired by a tiny software company for summer interns. At that time, He had great interests on PalmPilot devices. After reading the book "C the Complete Reference" by Herbert Schildt, he started to programming PocketC after work. It is not an easy task to achieve since Palm-Pilot has merely 2 Meg RAM total. I also believe that is one of the reason why he did it. Every morning at work, he would show me the latest progress. It was a fun experience to see a tiny language getting developed slowly. At the end of the summer, PocketC is finally finished for Palm-Pilot. With his permission, I ported PocketC for Windows CE during the school.

I hope you enjoying our little language

Kevin Cao 10/09/1999

PocketC Data Type and Variables


Basic Data Type

  • int
  • char
  • string
  • float

Identifier

PocketC identifier has the same rule as C indentifier. The first character must be a letter or an underscore and following characters must be either letters, digits or underscores

Variables

  • The following variable types are supported: int, float, char, string, pointer, and single-dimensional arrays.
  • Local variables must be declared before any code in a function.
  • Variable initializers are not yet supported. (e.g. int x=5; is not yet legal).
  • All variables, global and local, are initialized to zero or the empty string.
  • Variable names can be up to 31 characters long and are case sensitive.
Type Name Example
integer int 1, 2, 5, -789, 452349
floating point float -1.2, 3.141592, 5.7e-4
characters char 'a', 'b', '#'
strings string "Bob" "Katie" "Hello"
Variables are declared like this:
variable-type name[,name...];

Here are a few examples: 

  • int myInteger, row, column;
  • string name;
  • float pi;
  • char c, last, first;
  • pointer pi;
It is also possible to have an array of values. An array is a list of values that are stored in one variable. Arrays are declared like normal variables except that the variable name is followed by '[size]' where size is the number of item that the variable can hold. A declaration might look like this: 
int values[10];
string names[7];
Of course, arrays and normal variables can be declared together: 
int row, values[10], column;
string name, colors[8];

Local Variables

Variables that are declared inside a function are called local variables.  Local variables are only referenced by the statements inside of the function.  One restriction, You have to declare all local variables at the start of a function.

Global Variables

Opposite to local variables, global variables are know throughout the code and can be referenced by any port of the program.  In addition, their values are kept through the entire program execution.  

Pointers

A pointer is defined by the pointer type, not int*, for example. Importantly, pointers in PocketC are not typed. Instead, they take on the type of the data to which they point. Additionally, a pointer can refer to a function, and would be used as follows: 

func(int x) { return 5*x; }

main() {
   pointer ptr;
   int result;

   ptr = func;
   result = (*ptr)(7);
   puts("5*7=" + result);
}

Additionally, pointer values are not addresses to actual PalmOS or WindowsCE memory.

We will discuss more about pointers later on.

  

Assignment, Operators and Inc/Decrment

Assignment

Variable assignment is actually just another form of expression. Assignment is done in one of two ways--for a normal variable:
name = expression

and for an array:
name[index-expression] = expression

Here are a few examples: 

int myInt, numbers[3];
string myString;
...
myInt = 8;
myString = "Animaniacs";
numbers[0] = myInt + 5;
numbers[2] = numbers[0] * 8;

However, since PocketC is loosely typed, any type of value can be assigned to any type of variable and the value will be automatically converted: 

myString = 95; // The value of myString is now "95"
numbers[1] = "78"; // The value of numbers[1] is now 78;
numbers["2"] = "2"; // Another neat trick. numbers[2] is now 
2

Now, what are all the operators that can be used in an expression, and what is their associativity? Good question.

Operators

The following table is in order of precedence, lowest first.

Operator

Assoc

Description

=

right assigns the value of the expression on the right to the variable on the left. Evaluates to the expression on the right.

||

left logical 'or', evaluates to 0 if false, 1 if true

&&

left logical 'and'

== != < <= > >=

left relational operators. == (equal), != (not equal), <= (less than or equal), >= (greater than or equal). These evaluate to 1 if the expression is true, 0 otherwise

+ -

left addition, subtraction (subtraction cannot be used with a string argument)

* / %

left multiplication, division, modulus (cannot be used with strings, nor can modulus be used with floats)

- ! ++ - - ~ * [] () &

left - (negation), ! (logical 'not'), ++ (increment), -- (decrement), ~ (bitwise neg), [] (array subscript), () (function pointer dereference), & (address of ) (Of these, only the logical 'not' can be used with strings)

Notes: No shortcut logic is performed on the operands of || and &&
The compound assignment operators (+=, *=, etc.) are not supported.
The comma and conditional operators (?:) are not supported.

Bitwise Operators

PocketC supports a full complement of bitwise operators.  Bitwise operation is used for variable type int or char.  You cannot use bitwise operations on float or string data types.  

& AND
| OR
^ Exclusive OR (XOR)
~ One's complement
>> Shift Right
<<  Shift Left

 

Increment / Decrement

The ++ and -- operators are special in that they must be placed before or after a variable and modify the value of the variable. The ++ increments the value of a variable by one, while the -- decrements by one. The caveat is that if the ++/-- is placed in front of the variable, the expression evaluates to the value of the variable after it is incremented/decremented. If it is placed after the variable, the expression evaluates to the variable's previous value. Example: 

int myInt;
...
myInt = 8;
puts(++myInt); // Prints "9" to the output form

myInt = 8;
puts(myInt++); // Prints "8" to the output form, but myInt is now 9

 

Automatic Casting


Just like in assignments statements, automatic conversion takes place in every part of an expression. If the two arguments to an operator are of different types, one of arguments will be promoted to the less strict type. The promotion order is char to int to float to string. So in the expression: 
"Result is: " + 5;

The constant 5 is first promoted to a string, and the two strings are concatenated. This may have some undesirable side effects. For example, if you want to write an expression and result to the output form, you might do something like this: 

puts("5 + 7 = " + 5 + 7); // Prints "5 + 7 = 57"

This probably wasn't the desired outcome. Instead, you would want the expression evaluated first, then concatenated to the string. The parentheses can be used to accomplish this: 

puts("5 + 7 = " + (5 + 7)); // Prints "5 + 7 = 12"

One problem remains. Suppose you want to find the floating point value of a fraction of two integer. 

puts("7 / 5 = " + (7 / 5)); // Prints "7 / 5 = 1"

This output is because both arguments are integers, so the result is also an integer. To solve this, we can cast one of them to a float: 

puts("7 / 5 = " + ((float)7 / 5)); // Prints " 7 / 5 = 1.4"

This forces the integer 7 to a floating point number before dividing it by 5.

Declare Functions

Functions are the most important part of a program because they contain the actual instructions that make a program useful. All functions have a name and a parameter list (which may be empty) and are declared like the:
func-name([param-type param-name,...]) { statements }

Statements are discussed later, but for now, here are a few examples: 

area(int width, int height) {
   return width * height;
}

square(float x) {
   return x * x;
}

five() {
   return 5;
}

There is one special function name which all programs must have: main. The main function is the function which is called first in your program. When the main function exits, the program terminates. The main function must be declared with no paramters: 

// My Applet
main() {
   puts("Hello World");
}

Functions can also have local variables, which are variables that can only be accessed within the function that declares them. Global variables, however, can be accessed from anywhere. Local variables are declared in the same way that global variables are except that they immediately follow the opening brace of a function: 

// My Applet
main() {
   string localString;

   localString = "Hello World";
   puts(localString);
}

Before we go any further, we need to talk a little bit about expressions.

Expressions

An expression is any number of constants, variables, and function calls connected by operators and parentheses.

A constant is any value that is directly entered into the program, such as: 5 5.4 'a' "String"

A value stored in a variable can be accessed by just typing its name: myInteger name
However, if that variable is an array, each value must be accessed individually by index. The valid indices for a given array are 0 to n-1 where n is the number of values in the array. So an array declared: 

string names[4]

can be accessed like so: 

names[0] = "first name";
names[1] = "second name";
names[2] = "third name";
names[3] = "fourth name";

A function call consists of the name of a function, followed by an open paren, the parameter list, and a closing paren: 

area(5, 7);
square(8.9);
clear();
text(30, 55, "Game Over");

These three basic elements can be combined with operators: 

5 + 7 - area(12, 34);
square(5) * pi;
"Hello, " + "World";

Of course, function calls can have expressions in them as well: 

area(6+3, 8*9);
area(8 * square(4), 7);

Statements

Statements are the individual parts that make up the body of a function. The following are the available statements:

Statement Description
return; Returns immediately from the current function (with a default return value of integer 0)
return expr; Returns immediately from the current function, returning the value of the expression expr
if (expr) stmt Evaluates the expression expr, if its result is true (non-zero or non-empty string), the statement stmt is executed, otherwise stmt is skipped, and execution continues
if (expr) stmtA
else stmtB		 Evaluates the expression expr, if its result is true (non-zero or non-empty string), the statement stmtA is executed, otherwise stmtB is executed
while (expr) stmt The expression expr is evaluated. If it is true (non-zero or non-empty string), stmt is executed. The loop then begin again, evaluating expr and executing stmt until expr is no longer true. This means that stmt will never execute if expr is initially false
do stmt
while (expr)		 The same as while except that the statement stmt is executed before expr is evaluated. This guarantees that stmt will execute at least once
for (init;cond;iter)
stmt		 The initializer expression init is first evaluated. The condition expression cond is evaluated. If it is true, stmt is executed and the iterator expression iter is evaluated continuing the loop, otherwise the the for loop ends. Note: init is evaluated only once.
break; Immediately exits from the directly enclosing while/do/for loop.
continue; Immediately restarts the directly enclosing while/do/for loop. In a for loop, the iter expression is evaluated, followed by the cond expression and possibly the stmt
{ statements } A brace followed by a list of statements, followed by another brace is considered a single statement
expression; An expression followed by a semicolon is also considered to be a statement
switch (expr) {

case const1:
{ statements }

break;

default:
{ statements }

}

switch statement is a multiple-branch selection statement.  It tests the value of an expression against a list of integer, character, float or string.  When a match is found, the case block with that constant are executed.  The break statement can be used at the end of a case statement.  It will cause program to jump to the code after switch statement.  

Note: Regular ANSI C will not allow constant string in switch statement for branch selection.  Constant string is a variable type for PocketC.  So PocketC's switch statement can handle constant string. 

 


Statement Examples

return
Let's visit a previous example function to see how return works. 

five() {
   return 5;
}

Since the return value of the function five is always 5, we can use the function any place we would normal put the constant 5. 

puts("Five is " + five()); // Prints "Five is 5"

Also, since return causes the function to exit immediately, we could do this: 

five() {
   return 5;
   puts("This won't print");
}

and we would have the same effect.

if

lessThan5(int x) {
   if (x < 5)
      puts("Less than five");
   puts("Hello");
}

If this function is called with a number less than 5, "Less than five" will be printed followed by the word "Hello", otherwise, only the word "Hello" is printed.

if ... then

lessThan5(int x) {
   if (x < 5)
      puts("Less than five");
   else
      puts("Greater than or equal to five");
}

If this function is called with a number less than 5, "Less than five" is printed, otherwise "Greater than or equal to five" is printed.

while 

count() {
   int x;

   x = 5;
   while (x > 0) {
      puts(x);
      x = x - 1;
   }
}

This bit of code will print the numbers from 5 to 1 counting backwards. Notice that braces were placed around the two lines of code in the while loop to make them act as a single statement.

do ... while 

count() {
   int x;

   x = 6;
   do {
      x = x - 1; // could also be x--
      puts(x);
   } while (x > 0);
}

This bit of code (similar to the previous example) will print the numbers from 5 to 0 counting backwards. The zero is printed in this case because the expression x < 0 is not evaluated until after the loop

for 

output() {
   string list[4];
   int index;

   list[0] = "Zero";
   list[1] = "One";
   list[2] = "Two";
   list[3] = "Three";

   for (index = 0 ; index < 4 ; index++)
      puts(list[index]);
}

This example will print out "ZeroOneTwoThree". When we disect it we see that the array list is initialized first. We then reach the for loop. First, the initializer is evaluated, setting index to 0. Next, the condition is evaluated index < 4, which is true, so the body of the loop executes, printing "Zero". The iterator expression is then evaluated, increasing index by one. This continues until index is equal to 4, at which point the loop exits without executing the body again.

break 

count() {
   int x;

   x = 5;
   while (x > 0) {
      if (x == 1)
         break;
      puts(x);
      x = x - 1;
   }
}

In this slightly more complex piece of code, the counting goes on as it normally would, printing out "5432". However, when x reaches 1, break is executed, breaking out of th{he while loop early, before the 1 gets printed.

continue 

count() {
   int x;

   x = 6;
   while (x > 1) {
      x--; // Do the subtraction first
      if (x == 3)
         continue;
      puts(x);
   }
}

In this clearly contrived example, the output is "5421". When x reaches 3, the continue is executed, passing execution to the beginning of the loop, skipping over the puts.

switch statement

int    myInteger;

myInteger = 50;

switch (myInteger)

{

   case    40:

    case   30:    putsl("MyInteger is 40 or 30"); break;

    case    50:    putsl("MyInteger is 50");    break;

    default    :    puts("MyInteger is " + myInteger); 

 }

Note: if myInteger is 50, it will printMyInteger is 50

if myInteger is 40 or 30, it will print MyInteger is 40 or 30

Otherwise, it will print MyInteger is the actualMyInteger's value.

 


Resource

Most programs include bitmap images, sound clips as their resources. I usually like to keep my program in one binary format. When you beam software to another device, it is much easier to beam one file than multiple files. There is a special preprocessor keywoard for packing additional resource files into your app file.

syntax: #resource [resourceid] "resource file path" for example: #resource 1 "table.bmp "

When the compiler processes this line, it will try to find table.bmp file in the same directory with your main source file. When the file is found, the compiler will pack this resource file into the final app file.

During the runtime, it will unpack this file into a temp directory. You can find out the file path by calling builtin function loadres(int resourceid).

PocketC and COM -- File System Control 

by Kevin Cao cao@orbworks.com

Introduction:

In the past, PocketC developers for the WindowsCE platforms are limited to the 225 default APIs. The APIs covers most areas of the devices. However, developers have been asking more and more access to the features provided by the OS. My solution to this problem is to open up the COM access. With this article, I will show you how to use FileSystem Control through PocketC.

For all the activeX controls availiable for the WindowsCE platfroms from Microsoft "http://www.pocketc.net/release/distribute/ActiveXControls.zip"

Brief Note on the File System Control:

File System Control is an ActiveX control provided by Microsoft. This control has a COM object. It offers a few methods for you to access to the file system. There are many similar ActiveX controls that allow you to access many other parts of the operating system.

Each ActiveX control is identified by an unique ID. This unique id is generate when the original file system control author created this control. It reduces the chances of two ActiveX control having the same identity greatly.

#define CEFILESYS_GUID "{3F0C2794-5C3A-11D1-A717-00AA0044064C}"

In order to use the activeX control, you have to register it on the windows os first. On the WindowsCE, you need to have regsvrce.exe to register COM components.

This following code registered the dll on the device, assuming you downloaded regsvrce.exe to the windows directory, and mscefile.dll into the windows directory. They don't have to be in the windows directory.

Regsvrce.exe has a few options you can pass in. It also has an UI interface to allow you to register components manually.  To obtain a regsvrce.exe for your device, please download here.   "http://www.pocketc.net/release/Distribute/regsvrce.zip"

/i = install

/u =unstall

/s =silent, without a notification dialog popup for registering the control successfully.

register_filesystem()

{

exec("open", "/windows/regsvrce.exe", "/i \\windows\\MSCEFile.dll") ;

}

Implementation:

Now we have registered the File System ActiveX control on our device. We need to initialize the control, and keep the handle to the control, so we can keep reuse this

control over and over again. Just remember to release the control at the end of your program.

pointer globalptr_filesystem = 0;

startup_filesystem()

{

if (!comdispatch(CEFILESYS_GUID, globalptr_filesystem))

{

alert("Failed to initialize filesystem control");

return 0;

}

return 1;

}

cleanup_filesystem() { comrelease(globalptr_filesystem); }

After we have the filesystem control started, it is time to explore some of the methods. It is rather complex to complete a COM call, so I suggest you wrap the complexity within a simple PocketC function. In my example, I will show you how to find out a file length by using the file system control.

According to the Microsoft documention, the filesystem control has a method called FileLen. We need to find out the method's id using comgetidbyname. It takes the pointer to the filesystem control pointer, and a string, and an integer passing by reference.

FileLen also requires one input parameter for the actual file path. We first clean COM function argument buffer in memory by using comargclr(). comargadd is used to add the first parameter. VT_BSTR is an integer to tell the COM interface that I am passing a string. The second parameter for comargadd is a pointer. We passed in a string pointer. This string is the file path.

Now just use cominvoke function to do the actually calling on FileLen. The cominvoke takes a pointer for return values. We know that FileLen returns an integer, so i passed in a integer's pointer.

#define VT_BSTR 8

fsFileLen(string f)

{

int dispid = 0;

int size = 0;

comgetidbyname(globalptr_filesystem, "FileLen", dispid);

comargclr();

comargadd(VT_BSTR, &f);

cominvoke(globalptr_filesystem,dispid,&size);

comargclr();

return size;

}

Now let us see if it works by writing a testing function.

test_filesys()

{

startup_filesystem();

putsl("hello.txt size = " + fsFileLen("hello.txt"));

cleanup_filesystem();

}

Since we hide all of that complexity with a few wrapper functions. Our testing function can be very clean. In our testing function, it assumes that you have a "hello.txt" file on the root directory.

Conclusion

In PocketC, there are a few helper functions to allow you load an activex control, call its method and set/get properties.  This opens 20-30 current VBcontrols to PocketC developers. 

Include

Using the include keyword, it becomes possible to write programs in smaller chunks. The contents of the included file are functionally inserted into the line containing the include keyword.
Note: 

For WinCE, include must contain the full path name.  WinCE doesn't support relative path.


Example 

File  MyFunctions.pc

times5(int x) {

   return x*5;

}
Another memo: 
// My Program

#include "MyFunctions.pc"

main() {

   int y;

   y = times5(7);

   puts(y); // Prints 35

}
The compiler sees this as: 
// My Program

times5(int x) {

   return x*5;

}

main() {

   int y;

   y = times5(7);

   puts(y); // Prints 35

}

Special Characters

There are two ways to add special characters to a string. The first is by appending them by number, such as: 
str = "Here is a neat little square: " + (char)149;
The other method is through using escape sequences. The following escape sequences are supported:
Escape sequence \\ \' \" \n \r \t \x
Interpretation \ ' " newline carriage return tab character specified by the following two hex digits. Example: '\x95' is the block character (decimal 149)
So, to create a string that contains a quote: 
str = "She said \"I'm sorry,\" but it was too late...";

puts(str); // Prints: She said "I'm sorry," but it was too late...
PocketC Windows CE 's source code is in Unicode.  In order to make a unicode text file, you need to following a few rules.  The first two bytes must be 0xFF and oxFE.  

sample code for write unicode properly:

test_writeunicode(string data)
{
int handle; 
char byte1;
char byte2;
byte1 = 0xFF;
byte2 = 0xFE;
handle = fileopen("unicode.txt",1,FILE_CREATE|FILE_READWRITE);
writebyte(handle,byte1);
writebyte(handle,byte2);
filewrite(handle,data,strlen(data)*2);
fileclose(handle);
}

 

Pointers and Arrays

Note: Pointers are an advanced topic, which should be dealt with after the user is familiar with all the other programming concepts.

All variables are stored at some address in memory. A pointer is a variable which refers to another variable by containing that variable's address.

There are two primary operators which are used with pointers, * and &. The * operator dereferences the pointer. A dereferenced pointer acts just like the data to which it points. The & operator returns the address of a given variable. To illustrate: 

pointer p, q;
int i;

main() {
  i = 5;
  p = &i;   // Assign the address of 'i' to the pointer 'p'
            // now, typing '*p' is the same as typing 'i'
  puts(*p); // Print the value of 'i'
  *p = 7;   // Assign 7 to 'i'
  q = p;    // Assign the value of 'p', which is the address of 'i', to 'q'
            // now, typing '*q' is the also the same as typing 'i'

  // Things not to do
  p = 8;    // BAD! Don't assign a constant value to a pointer
  *i = 9;   // BAD! Don't try to dereference a non-pointer
}

A pointer can also be used to take the address of a function (but NOT a built in function!). Unlike variables, however, the & operator is NOT used. Calling a function through a pointer is a little tricky. First, the code looks ugly. Second, no error checking can be done on the parameters, so type conversions are not done and the number of arguments is not confirmed. For example: 

func(int x) { return 5*x; }

main() {
  int result;
  pointer ptr;

  ptr = func; // Take the address of a function
  result = (*ptr)(5); // call the function (ugly)

  // Things not to do
  result = (*ptr)("5"); // this won't work, since the string
                        // isn't converted to an integer
  result = (*ptr)(5,7); // this will compile, but will result
                        // in stack corruption because the
                        // wrong number of arguments are used
}

Pointers and arrays
Pointers and arrays are fairly similar. Pointers can use the [] operator, and an array variable (when not used with []) results in the address of the first element. For example: 

int array[5];
pointer p;

main() {
  p = array; // Assign the address of the first element of
             // 'array' to 'p'
  *p = 7;    // Assign 7 to array[0]
  p[1] = 8;  // Assign 8 to array[1]
}

This enables the pointers to arrays to be passed as function parameters. This also allows the user to implement their own version of two-dimensional arrays. By creating an array of pointers, each of which is a pointer to an array (or part of one), a two-dimensional array can be simulated. 

int array[100];
pointer twod[10]; // after init(), this can be treated
                  // like at 10x10 matrix

init() {
  int i;
  for (i=0;i<10;i++)
    twod[i]=array + i*10; // Pointer arithmetic
}

main() {
  int x, y;
  init();
  for (x=0;x<10;x++)
    for (y=0;y<10;y++)
      twod[x][y]=x * y; // Sets array[x*10 + y] = x*y
}

Pointer arithmetic
Pointer values can used in a limited number of expression. You can add and subtract from a pointer (and, thus, can use the increment and decrement operators as well). When you add 1 to a pointer, the pointer points to the next value in memory. Similarly, when you subtract 1 from a pointer, the pointer points to the previous value in memory. Caution should be used when using pointer arithmetic, because dereferencing an invalid memory location will cause an error during run time.

Introduction


A WinCE database is like a big spreadsheet table. In a regular spreadsheet, you have multiple columns and rows. In the WinCE database, Row is called record and columns are called properties. Each record can contain 0 or more properties. Each propertie is defined by a standard datatype, like integer or string.

Figure 1. A sample WinCE database

100 John Smith 11 Broadway Cleveland
101 Nicky Tayler 1 Sunny Drive MountainView
102 Blues Brother 532 194RD PL NE Seattle

You probably know something about SQL if you are using database functions. Microsoft announced the SQL support for WindowsCE . Right now, you have to write functions to manipulate the data in your database.

Memory on your WinCE machine is very limited. Before you start working on your database, take a moment to design the database layout to minimize the storage requirement.

Create a database


PocketC Database APIs are suppose to be simple and easy to use. If you have the time or luxary, go search on http://msdn.microsoft.com/ for WindowsCE database functions. You will thank us for the simple database interface in PocketC. In this section, we are going to learn how to create, open and close a database.

Create a database

Once you have a clear idea how the database or "spreadsheet" is going to look like, it is time to create the database with the dbcreate function. It takes two arguments:

Database name: The name can be up to 32 characters long. If you pass a longer name, the first 32 characters will be treated as the database name. All databases will be placed in the \Database folder.

Database type: an integer that can be used later on for search database of certain type. You can decide the number for your own database. Don't assume the number you pick is used only for your database. Other database might use the same number.

Return value: if dbcreate is successful, it returns an integer. This integer is the object identifier for your database. It can be used to open the database you just created. see dbopen for detail.

When can dbcreate fail?

  • The WinCE database storage is running out of space.
  • Another database is already using the name

When it fails, the return value is 0. You can call getlasterror to obtain the error information.

<Note to Kevin: Need to explain GetLastError later and the error handling system>

Open a database

After a database is created successfully, you can open it now. A good programming practice is to check the return value of dbcreate before call dbopen. If you don't check, your program might run on one user's machine, and fail on the other user's machine. For example: User B has a database called "TodoList", and your program tried to create a database with the same name.

*Each WinCE database can be distinguished from each other by using its object id or its name.

dbopen is the function you need to open a database. It takes two parameters:

  • Database Object ID: An integer which identify the database. It can be obtained by using dbcreate or dbenum.
  • Database name: The name can be up to 32 characters long. If you pass a longer name, the first 32 characters will be treated as the database name. All databases will be placed in the \Database folder.

You can specify either object id or name to open the database. If you know the function name only, just use 0 for the object ID. If you know the function object ID only, just use an empty string "" for the database name parameter.

Return value: If the database is opened, the return value is the object id of this database. Otherwise, the return value is 0.

When can dbopen fail?

  • the operating system doesnot have enough memory to open the database
  • the database doesnot exist with the OID or name you provided.

Note: PocketC Database API only supports opening one database at a time. If you want to open a second database, you must close the current database first.

Close Database

Since we can only open one database at one time, close a database is pretty simple. Just call dbclose().

Return value can be 1 or 0. 1 means the database is closed. 0 means the function failed to close the database.

Section One Summary

In Section One, we learned how to create, open and close a database on WindowsCE.

  • dbcreate(string name, int dbtype) -- create a new database. it needs a name and a type.
  • dbopen(int oid, string name) -- open a database by its object id or name
  • dbclose() -- close current opening database.

It is time to write a few lines of PocketC code to review what you have learned. After you create a new database, the big question is that how can you tell if your database is actually created? Please read Section Two to find out how!

Enumerate database


In this section, we are going to find out all the database on your WindowsCE device!  You will probably be surprised by the number of databases.

Enumerate Database

dbenum is the function can be used to enumerate all the databases.  It takes two parameters:

  • int bFirst:  you must use 1 for parameter bFirst if you are using dbenum to get the first database.  After that, you just keep using 0 until dbenum returns 0.
  • int databasetype: Do you remember dbcreate takes a database type parameter? You can use it here to specify what type of database you want to enumerate through.  If you want to see all the database regardless of their type, just use 0 for database type.

Return value:

dbenum returns one database object id each time it is called.   Once all of the databases are enumerated, dbenum returns 0.  You will need the object id to find out more about the database.

Database Attributes

Now we have the database's object id, we can find out the database's name, physical storage size in bytes and number of records.

string dbname(int oid) -- returns database name in a string. If failed, return an empty string ""

int dbsize(int oid) -- returns database physical storage size in bytes. If failed, returns 0

in dbnrecs(int oid) -- returns total records in the database. If failed, return 0

For above three functions, if parameter oid is 0, the function will return current open database's attributes.

Show me the CODE!

Here is a short segment of PocketC source code to list all the database.

listdb()
{
    int ret;    int oid;
    ret =    dbenum(1,0);
    if (ret==0) return;
    putsl("List all the databases");
    putsl("Name----------Size----------------NumRecords------");
    while ((oid=dbenum(0,0))!=0)
    {
        putsl(dbname(oid) + "\t\t" + dbsize(oid) + "\t" + dbnrecs(oid));
     }
}

Output:

List all the databases
Name----------Size----------------NumRecords------
testdb        456    2
\RecycleInfo        480    1
\Categories Database        1744    20
Contacts Database        380    0
Tasks Database        380    0
Appointments Database        380    0
\DesktopPositions        1444    11
\EventNotifications        600    5
\UserNotifications        380    0

The first database in the list is called testdb, which is created using PocketC.  We will show you how to write actual data to the database in the next section.

*Note: Did you notice that some database with a backslash afront of their names?  These databases are the Windows CE system databases.  Don't modified them unless you know what you are doing.  Btw, Don't forget to add a backslash, otherwise, \D will be converted into some character, and dbopen will fail.   You need to call dbopen(0,"\\DesktopPositions").  

Read database contents


Don't you want to find out what is in those databases listed by our code?  I know I want to.  In this section, we are going to learn how to dump the entire database out to the console screen.   

The concept is fairly simple.  We are going to go through each record in the database, and display the record properties one by one.  The number of the record can be found by using dbnrecs(int oid).  The tricky part is to find out the record properties.

int dbrecpropcnt() -- returns number of properties in the current record.  If failed, return -1.

int dbrecproptype(int index) -- returns the property type by using its index.  Windows CE database supports following data types.

#define CEVT_I2 2
#define CEVT_UI2 18
#define CEVT_I4 3
#define CEVT_UI4 19
/*Not Supported */ #define CEVT_FILETIME 64
#define CEVT_LPWSTR 31
/*Not Supported */ #define CEVT_BLOB 65
CEVT_I2
A 16-bit signed integer.
CEVT_I4
A 32-bit signed integer.
CEVT_LPWSTR
A null-terminated string.
CEVT_UI2
A 16-bit unsigned integer.
CEVT_UI4
A 32-bit unsigned integer.

We currently don't support CEVT_FILETIME and CEVT_BLOB.   PocketC users will not be able to access CEVT_FILETIME and CEVT_BLOB properties.   I am working on a solution, and open for suggestions as well.  It is possible to reuse the existing time function to obtain the CEVT_FILETIME.

dbrecpropval(int index) -- returns the property value by using its index.  Possible return type is int and string. 

It seems we almost have everything we needed.  We can find out the property count of the current record,  the property type and value.  When we call dbopen to open a database, it automatically set the current record to the first record in the database.  We need a function that allow us to move current record position.

dbseek(int seektype, int dwValue) -- seek the record depends on the seek type and seek value.  Returns record object id.  If failed, return 0.

#define CEDB_SEEK_CEOID 0x00000001
#define CEDB_SEEK_BEGINNING 0x00000002
#define CEDB_SEEK_END 0x00000004
#define CEDB_SEEK_CURRENT 0x00000008

Again, here is the list of seek type we support at this moment.  

Seek Type Seek Value
CEDB_SEEK_CEOID
Seek until finding an object that has the specified object identifier. The dwValue parameter specifies the object identifier. This type of seek operation is very efficient.
CEDB_SEEK_BEGINNING
Seek until finding the record at the specified position from the beginning of the database. The dwValue parameter specifies the number of records to seek.
CEDB_SEEK_END
Seek backward for the specified number of records from the end of the database. The dwValue parameter specifies the number of records.
CEDB_SEEK_CURRENT
Seek backward or forward from the current position of the seek pointer for the specified number of records. The dwValue parameter specifies the number of records from the current position. The function seeks forward if dwValue is a positive value, or backward if it is negative. A forward seek operation is efficient.

Show me the CODE!

This function dumps the contents of a database.

checkdb(int oid)
{
    int ret;    int cnt; int i; int reccnt; int j;
    putsl("----------------------------------------");
    ret =    dbopen(oid,"");
    if (ret==0)
    {
        putsl(dbname(0) + " open failed");
        return;
    }
    reccnt = dbnrecs(0);
    for (j = 0; j < reccnt; j++)
    {
        cnt = dbrecpropcnt();
        for (i=0; i < cnt; i++)
        {
            puts("("+ dbrecproptype(i) + " " + dbrecpropval(i)+ ")");
        }
        dbseek(8,1);
        putsl("");
    }
    putsl("----------------------------------------");
    ret = dbclose();
}
 
Database Output for a database with name "\Categories Database"
 
\Categories Database        1744     20
----------------------------------------
(2 0)(2 1)(31 Business)(2 0)(2 0)(2 0)
(2 1)(2 1)(31 Competition)(2 0)(2 0)(2 0)
(2 2)(2 1)(31 Favorites)(2 0)(2 0)(2 0)
(2 3)(2 1)(31 Gifts)(2 0)(2 0)(2 0)
(2 4)(2 1)(31 Goals/Objectives)(2 0)(2 0)(2 0)
(2 5)(2 1)(31 Holiday)(2 0)(2 0)(2 0)
(2 6)(2 1)(31 Holiday Cards)(2 0)(2 0)(2 0)
(2 7)(2 1)(31 Hot Contacts)(2 0)(2 0)(2 0)
(2 8)(2 1)(31 Ideas)(2 0)(2 0)(2 0)
(2 9)(2 1)(31 International)(2 0)(2 0)(2 0)
(2 10)(2 1)(31 Key Customer)(2 0)(2 0)(2 0)
(2 11)(2 1)(31 Miscellaneous)(2 0)(2 0)(2 0)
(2 12)(2 1)(31 Personal)(2 0)(2 0)(2 0)
(2 13)(2 1)(31 Phone Calls)(2 0)(2 0)(2 0)
(2 14)(2 1)(31 Status)(2 0)(2 0)(2 0)
(2 15)(2 1)(31 Strategies)(2 0)(2 0)(2 0)
(2 16)(2 1)(31 Suppliers)(2 0)(2 0)(2 0)
(2 17)(2 1)(31 Time & Expenses)(2 0)(2 0)(2 0)
(2 18)(2 1)(31 VIP)(2 0)(2 0)(2 0)
(2 19)(2 1)(31 Waiting)(2 0)(2 0)(2 0)
----------------------------------------

Write data to a database


After going through the previous three sections, you should have enough knowledge to browse through any WindowsCE databases. It is time to learn how to write to your own database, or modify the existing databases.

To make learning interesting, we are going to create a stock portfolio database.

Figure 2. A sample stock portfolio. The first column is the index number for each company stock. The second column is the company name, the third is the company's stock symbol and the l:=ast column is how many shares you have.

1001 Intel Corp INTC 60
1002 Net Bank NTBK 300
1003 QWest QWST 50

The name of our sample stock is called "sample stock", and the type for our database is 20000. You can use a different name and different value for the database type. Just remember not to use any existing database names.

Review Section One, you should be able to write following source code which will create and open the database.

Sample source code:

int dboid;
dboid = dbcreate("sample stock",20000);
if (dboid == 0)
{ alert("failed to open database"); return; }
dbopen(dboid,"");

Now we are almost ready to write data to the database.

First of all, we need to learn a few tricks with dbrecwrite function.

dbrecwriteprop(int rec_oid, int prop_type, int prop_id, void prop_value)

int rec_oid : each record in the database has its own object identifier. You can obtain the rec_oid by using dbrecnow(). If rec_oid is 0, a new record will be written.

int prop_type : each property has a property type. The property type can be

CEVT_I2
A 16-bit signed integer.
CEVT_I4
A 32-bit signed integer.
CEVT_LPWSTR
A null-terminated string.
CEVT_UI2
A 16-bit unsigned integer.
CEVT_UI4
A 32-bit unsigned integer.

int prop_id : each property can have its identification. The identification is simply an positive integer value which can be decided by the developer.

void prop_value: depends on the type you supplied in prop_type. If prop_type is CEVT_I4 a 32-bit signed integer, you better have a integer for prop_value.

For example, I want to create a new record with one integer property. The property's ID is 1, and Value is 1000.

Here is the code: int recoid; recoid = dbrecwriteprop(0, CEVT_I4, 1,(int) 1000);

*Remember to put typecast around the property value parameter.

What about one more property for this record? The good thing we saved the record object id for the new record we just created. Now we can use recoid again in the next call to dbrecwriteprop.

The second property is a string, its ID is 2, and Value is "Intel Corp".

recoid = dbrecwriteprop(recoid,CEVT_LPWSTR,2,(string)"Intel Corp");

*One more time, Remember to put typecast around the property value parameter. WinCE database doesnot support Float or Char Property Type. So if you have float or character values, just type cast them into string or int.

Now, Let's say I want to change first property's value to 1001. Sounds difficult? Nah.

recoid = dbrecwriteprop(recoid, CEVT_I4, 1, (int) 1001);

Now the record should look like

1001 Intel Corp

 

Review dbrecwrite(...)

Function dbrecwrite is a pretty useful function.   Let us review what it just did for us. 

  • Create a new record with one property
  • Update property in a record
  • Add property to a record

Since this function can do a many things at once, please be careful when you are using it.  I am going to show you a sample code which write our stock data into one database.

Show me the CODE!

storedb()
{
    int recoid;
    /* line 1 */
    recoid =    dbrecwrite(0,CEVT_I4,1,(int)1001);
    recoid =     dbrecwrite(recoid,CEVT_LPWSTR,2,(string) "Intel Corp");
    recoid =     dbrecwrite(recoid,CEVT_LPWSTR,3,(string) "INTC");
    recoid =    dbrecwrite(recoid,CEVT_I4,4,(int)60);

    /* line 2 */
    recoid =    dbrecwrite(0,CEVT_I4,1,(int)1002);
    recoid =     dbrecwrite(recoid,CEVT_LPWSTR,2,(string) "Net Bank");
    recoid =     dbrecwrite(recoid,CEVT_LPWSTR,3,(string) "NTBK");
    recoid =    dbrecwrite(recoid,CEVT_I4,4,(int)300);

    /* line 3 */
    recoid =    dbrecwrite(0,CEVT_I4,1,(int)1003);
    recoid =     dbrecwrite(recoid,CEVT_LPWSTR,2,(string) "QWest");
    recoid =     dbrecwrite(recoid,CEVT_LPWSTR,3,(string) "QWST");
    recoid =    dbrecwrite(recoid,CEVT_I4,4,(int)50);
}

Console Output :

----------------------------------------
(3 1003)(31 QWest)(31 QWST)(3 50)
(3 1002)(31 Net Bank)(31 NTBK)(3 300)
(3 1001)(31 Intel Corp)(31 INTC)(3 60)
----------------------------------------

*Note: We created Intel Record first, and it is pushed one lower every time when a new record is written to the database.

Conclusion


Section Five... I hope you are not bored to death right now.   If you made this far, you are capable of writting a simple database browser and you should know following basic concepts:

  • Database is made up by many records
  • Record is made up by many properties
  • Property can be an integer or a string
  • Each item in the database has its own indentification number.   Database has object id, Record has object id and Property has its own id
  • PocketC can only open one database at a time

Before we go any furthor, I strongly suggest you write a small database browser, and create a database with your own data. 

.... < a few hours later > ....

Now, here is a list of additional functions for you do play with.

dbrecdelprop(int recoid, int proptype, int propid); 

parameters:

  • int recoid -- record object id
  • int proptype -- the property you want to delete's type
  • int propid -- the property you want to delete's ID

Description:

  • Delete one property from the record

Return:

  • returns record id if successful.  If function failed, return 0.

dbrecdel(int recoid)

parameters:

  • int recoid -- record object id

Description:

  • Delete one record

Return:

  • 1 indicates success. 0 indicates failure.  The function could fail when you pass into a wrong or invalid record object id

dbrecnow()

Description:

  • Get current record object id.  When you are iterating through the database, you can obtain the current record object id by call dbrecnow.

Return:

  • 0 indicates failure.  The function should return the record object id for the current reading/writing record

dbdelete

dbdelete(int dboid)

parameters:

  • int dboid -- database object id

Description:

  • Delete one database

Return:

  • 1 indicates success. 0 indicates failure.  The function could fail when you pass into a wrong or invalid database object id or another program is using the database at this moment.

Appendix -- PocketC Database API


dbcreate(string dbname, int dbtype)
-- create database with name and type

dbopen(int dboid, string dbname)
-- open database by using database object id or name

dbclose()
-- close database

dbdelete(int dboid)
-- delete database

dbseek(int seektype, int seekvalue)
-- seek database in various ways

dbrecnow()
-- get current record object id

dbrecdelprop(int recoid, int proptype, int propid); 
-- delete property from a record

dbrecdel(int recoid)
-- delete a record

dbrecwrite(int recoid, int proptype, int propid, void propvalue)
-- write one property to the database

dbrecread(int proptype, int propid)
-- read one specific property from the database

dbsize(int dboid)
-- return database size

dbname(int dboid)
-- return database name

dbnrecs(int dboid)
-- return database record numbers

dbenum(int first, int dbtype)
-- enumerate through databases with certain type

dbrecproptype(int index)
-- find out property type

dbrecpropcnt()
-- find out property count

dbrecpropval()
-- find out property value

 

PocketC/CE API

Console
Draw
Event
File
GUI
Math
Registry
Serial
System
Sound
String
Time
Database
Memory
COM
COM FileSystem
InfraRed

Console


puts(string text)
putsl(string text)
gets(string prompt)
clear()

Draw


drawimage(string filename, int x, int y, int w, int h, int sizeratio,int flag)
CaptureBmp(int x,int y, int w, int h, string filepath)
imgload(string filename, int scale ,int max_width,int max_height)
imgunload(int imghandle)
imgtrans(int imghandle, int xpos,int ypos,int red, int green, int blue)
imgstretchblt(int imghandle, int destx,int desty, int destw,int desth, int srcx, int srcy, int srcw,int srch, int rop]
imgbitblt(int imghandle, int destx,int desty, in